Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A512U816

Protein Details
Accession A0A512U816   
Localization Confidence High
Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-25NPTISRLRKKVNKDDENKKANLHydrophilic
33-58SKKPKPTRSMLQLKKKKRNSPTEEACHydrophilic
NLS Segment(s)
PositionSequence
11-50RKKVNKDDENKKANLSRPKNSQSKKPKPTRSMLQLKKKKR
Subcellular Location(s) cyto_nucl 14, nucl 23.5
Family & Domain DBs
Amino Acid Sequences MEDNPTISRLRKKVNKDDENKKANLSRPKNSQSKKPKPTRSMLQLKKKKRNSPTEEACSNLPTKSGGRAFPETEHSGQYFVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.78
3 0.79
4 0.84
5 0.84
6 0.82
7 0.74
8 0.68
9 0.61
10 0.59
11 0.6
12 0.56
13 0.53
14 0.55
15 0.62
16 0.67
17 0.65
18 0.68
19 0.69
20 0.73
21 0.76
22 0.78
23 0.8
24 0.76
25 0.79
26 0.76
27 0.74
28 0.74
29 0.72
30 0.73
31 0.73
32 0.77
33 0.8
34 0.82
35 0.81
36 0.79
37 0.81
38 0.79
39 0.8
40 0.79
41 0.76
42 0.69
43 0.63
44 0.54
45 0.46
46 0.38
47 0.28
48 0.2
49 0.15
50 0.15
51 0.2
52 0.22
53 0.23
54 0.27
55 0.32
56 0.33
57 0.33
58 0.38
59 0.37
60 0.35
61 0.35
62 0.3