Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A512UI30

Protein Details
Accession A0A512UI30    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MNTMTTKGPKHPKKMKTDRNVTMMKHydrophilic
NLS Segment(s)
PositionSequence
10-16KHPKKMK
Subcellular Location(s) nucl 20.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MNTMTTKGPKHPKKMKTDRNVTMMKPSSRSKKEIIRLKADMKTLEVREAKMLRTLTTVLKSNEQVNVNLSQQLTMIKEALTNEISSFVAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.86
4 0.88
5 0.83
6 0.81
7 0.77
8 0.66
9 0.64
10 0.6
11 0.52
12 0.46
13 0.46
14 0.48
15 0.48
16 0.51
17 0.47
18 0.49
19 0.56
20 0.6
21 0.59
22 0.56
23 0.56
24 0.56
25 0.55
26 0.48
27 0.4
28 0.33
29 0.31
30 0.25
31 0.27
32 0.23
33 0.2
34 0.22
35 0.23
36 0.21
37 0.21
38 0.21
39 0.16
40 0.17
41 0.18
42 0.16
43 0.18
44 0.22
45 0.19
46 0.21
47 0.23
48 0.23
49 0.26
50 0.25
51 0.23
52 0.22
53 0.23
54 0.21
55 0.22
56 0.2
57 0.15
58 0.14
59 0.16
60 0.15
61 0.13
62 0.13
63 0.1
64 0.12
65 0.13
66 0.16
67 0.15
68 0.14
69 0.13
70 0.15