Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A512UH02

Protein Details
Accession A0A512UH02   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
25-46EIEETRKRKRSQTRRQIKNGGSHydrophilic
NLS Segment(s)
PositionSequence
31-35KRKRS
Subcellular Location(s) cyto 4, cyto_nucl 13.5, nucl 21
Family & Domain DBs
Amino Acid Sequences MFANGHEKARIQLDFTLVDNKRLLEIEETRKRKRSQTRRQIKNGGSLTAAEANKIFSARPQRQNPQNGHVTDPGIELSEAITRNPRRCGICKIPGNQRETCPEGFDKVKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.3
4 0.25
5 0.27
6 0.26
7 0.24
8 0.23
9 0.22
10 0.22
11 0.17
12 0.23
13 0.3
14 0.39
15 0.45
16 0.49
17 0.56
18 0.58
19 0.62
20 0.67
21 0.68
22 0.69
23 0.74
24 0.8
25 0.82
26 0.88
27 0.87
28 0.78
29 0.76
30 0.66
31 0.56
32 0.46
33 0.36
34 0.29
35 0.26
36 0.23
37 0.14
38 0.13
39 0.12
40 0.12
41 0.12
42 0.1
43 0.08
44 0.17
45 0.24
46 0.33
47 0.38
48 0.45
49 0.53
50 0.61
51 0.61
52 0.57
53 0.57
54 0.49
55 0.47
56 0.41
57 0.34
58 0.27
59 0.24
60 0.18
61 0.12
62 0.11
63 0.08
64 0.07
65 0.1
66 0.09
67 0.09
68 0.17
69 0.21
70 0.25
71 0.29
72 0.34
73 0.36
74 0.4
75 0.49
76 0.5
77 0.55
78 0.59
79 0.62
80 0.67
81 0.68
82 0.69
83 0.64
84 0.59
85 0.56
86 0.53
87 0.47
88 0.42
89 0.37
90 0.38