Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A512UBR6

Protein Details
Accession A0A512UBR6    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
87-112NLPAHPQKPYPQKPHSQNPSRAKRLDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MASGANTEPTVSTLLAPSDDHAGSEMPYSRVENGVTKALGPENAPTKRAPTSPSKACQTDQKVDEKAKVDYKTVRQTVRQTDQKLPNLPAHPQKPYPQKPHSQNPSRAKRLDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.12
4 0.11
5 0.13
6 0.13
7 0.12
8 0.12
9 0.12
10 0.11
11 0.13
12 0.14
13 0.11
14 0.13
15 0.14
16 0.14
17 0.15
18 0.15
19 0.16
20 0.16
21 0.18
22 0.16
23 0.15
24 0.15
25 0.15
26 0.14
27 0.12
28 0.13
29 0.18
30 0.19
31 0.2
32 0.19
33 0.21
34 0.23
35 0.23
36 0.24
37 0.24
38 0.3
39 0.34
40 0.38
41 0.4
42 0.39
43 0.39
44 0.43
45 0.41
46 0.4
47 0.37
48 0.37
49 0.37
50 0.36
51 0.38
52 0.33
53 0.31
54 0.31
55 0.29
56 0.27
57 0.29
58 0.34
59 0.39
60 0.42
61 0.41
62 0.4
63 0.45
64 0.51
65 0.55
66 0.56
67 0.52
68 0.56
69 0.62
70 0.64
71 0.62
72 0.57
73 0.54
74 0.5
75 0.51
76 0.51
77 0.47
78 0.46
79 0.45
80 0.51
81 0.56
82 0.63
83 0.67
84 0.65
85 0.71
86 0.74
87 0.81
88 0.83
89 0.82
90 0.83
91 0.84
92 0.87
93 0.86