Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A512UJ00

Protein Details
Accession A0A512UJ00    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
135-157ILAARPSYKKQLAKREQKKRTWFHydrophilic
NLS Segment(s)
PositionSequence
147-153AKREQKK
Subcellular Location(s) nucl 14.5, mito_nucl 13.333, mito 10, cyto_nucl 9.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR037507  MrpL25  
IPR040922  MRPL25_dom  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
Pfam View protein in Pfam  
PF18126  Mitoc_mL59  
Amino Acid Sequences MSLSPKEAFAKLPQKLHNFFIRYPPRPFASYSDKPSTISDPTCNPFLPNKNSDTGRWHSAKVSMRKSADLFKMARKYGLEELLPPIPHRKFYEDKYNNKNWMRGVLFQKKQKWERELPEKLEKRRIAMEKMDETILAARPSYKKQLAKREQKKRTWF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.56
3 0.59
4 0.58
5 0.53
6 0.5
7 0.53
8 0.56
9 0.54
10 0.55
11 0.55
12 0.51
13 0.48
14 0.49
15 0.45
16 0.44
17 0.46
18 0.48
19 0.5
20 0.46
21 0.46
22 0.46
23 0.43
24 0.38
25 0.33
26 0.28
27 0.27
28 0.29
29 0.29
30 0.27
31 0.26
32 0.28
33 0.33
34 0.36
35 0.34
36 0.34
37 0.37
38 0.38
39 0.38
40 0.38
41 0.35
42 0.35
43 0.34
44 0.32
45 0.28
46 0.33
47 0.38
48 0.4
49 0.4
50 0.4
51 0.39
52 0.4
53 0.41
54 0.39
55 0.34
56 0.31
57 0.27
58 0.27
59 0.31
60 0.29
61 0.29
62 0.24
63 0.24
64 0.22
65 0.23
66 0.18
67 0.13
68 0.16
69 0.16
70 0.16
71 0.14
72 0.18
73 0.16
74 0.19
75 0.2
76 0.23
77 0.25
78 0.29
79 0.4
80 0.42
81 0.5
82 0.55
83 0.6
84 0.62
85 0.6
86 0.59
87 0.48
88 0.47
89 0.42
90 0.4
91 0.42
92 0.44
93 0.48
94 0.52
95 0.58
96 0.6
97 0.65
98 0.66
99 0.65
100 0.63
101 0.66
102 0.7
103 0.7
104 0.68
105 0.72
106 0.72
107 0.7
108 0.71
109 0.63
110 0.56
111 0.57
112 0.56
113 0.5
114 0.49
115 0.5
116 0.44
117 0.45
118 0.42
119 0.33
120 0.29
121 0.27
122 0.23
123 0.17
124 0.14
125 0.16
126 0.19
127 0.24
128 0.32
129 0.37
130 0.42
131 0.5
132 0.61
133 0.68
134 0.76
135 0.82
136 0.85
137 0.87