Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A512UP53

Protein Details
Accession A0A512UP53    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
10-32ALSRWTVDPHPRPRKKPALNLASHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011425  Med9  
Gene Ontology GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF07544  Med9  
Amino Acid Sequences MYPDFYPTTALSRWTVDPHPRPRKKPALNLASVTPTQAPSPPIAPNRPSMTSLPPHSELPSNGANHDTINAPKTEEDRALLKKLAEIQLLPDLFALLQRVETGEIKGQDFDNHAGPIRLKLNNIRMYLQEVEGICETVEERGKKIEMLKDCNDRRASFLSDFNKRVVKDLSQM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.31
3 0.36
4 0.45
5 0.53
6 0.63
7 0.68
8 0.73
9 0.78
10 0.83
11 0.81
12 0.82
13 0.82
14 0.79
15 0.75
16 0.71
17 0.63
18 0.56
19 0.48
20 0.39
21 0.3
22 0.21
23 0.18
24 0.18
25 0.16
26 0.14
27 0.16
28 0.21
29 0.24
30 0.28
31 0.29
32 0.33
33 0.36
34 0.36
35 0.36
36 0.33
37 0.33
38 0.33
39 0.34
40 0.34
41 0.32
42 0.31
43 0.29
44 0.29
45 0.25
46 0.24
47 0.25
48 0.21
49 0.19
50 0.19
51 0.17
52 0.15
53 0.16
54 0.13
55 0.1
56 0.1
57 0.1
58 0.1
59 0.11
60 0.12
61 0.13
62 0.12
63 0.12
64 0.15
65 0.17
66 0.18
67 0.18
68 0.17
69 0.16
70 0.19
71 0.19
72 0.15
73 0.13
74 0.12
75 0.15
76 0.15
77 0.14
78 0.11
79 0.09
80 0.08
81 0.09
82 0.08
83 0.04
84 0.04
85 0.04
86 0.05
87 0.06
88 0.07
89 0.08
90 0.1
91 0.11
92 0.11
93 0.12
94 0.12
95 0.12
96 0.13
97 0.14
98 0.13
99 0.13
100 0.13
101 0.13
102 0.13
103 0.15
104 0.17
105 0.17
106 0.17
107 0.22
108 0.3
109 0.35
110 0.37
111 0.35
112 0.32
113 0.35
114 0.34
115 0.29
116 0.24
117 0.18
118 0.19
119 0.18
120 0.17
121 0.12
122 0.11
123 0.11
124 0.11
125 0.16
126 0.14
127 0.15
128 0.18
129 0.19
130 0.21
131 0.26
132 0.3
133 0.31
134 0.37
135 0.43
136 0.51
137 0.53
138 0.59
139 0.58
140 0.52
141 0.49
142 0.47
143 0.46
144 0.38
145 0.44
146 0.44
147 0.47
148 0.48
149 0.48
150 0.49
151 0.44
152 0.45
153 0.42