Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A512U7S1

Protein Details
Accession A0A512U7S1    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
86-115LAEKVEKASRQQRKQKKNRDKKIFGTQTTHHydrophilic
NLS Segment(s)
PositionSequence
92-108KASRQQRKQKKNRDKKI
Subcellular Location(s) mito 10, cyto 9, cyto_nucl 8.5, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MVITNPLLARRQFVIDVLHPNRANVSKDELRERLSEVYKADKDAVSVFGFRTQFGGGKSTGFGLIYQSVADAKRFEPAYRLVRYGLAEKVEKASRQQRKQKKNRDKKIFGTQTTHAKKVAKRNAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.33
4 0.32
5 0.38
6 0.35
7 0.35
8 0.37
9 0.36
10 0.35
11 0.27
12 0.33
13 0.3
14 0.33
15 0.39
16 0.38
17 0.37
18 0.35
19 0.36
20 0.33
21 0.3
22 0.29
23 0.24
24 0.29
25 0.27
26 0.27
27 0.26
28 0.21
29 0.2
30 0.18
31 0.19
32 0.13
33 0.13
34 0.12
35 0.14
36 0.15
37 0.14
38 0.14
39 0.12
40 0.13
41 0.13
42 0.14
43 0.1
44 0.1
45 0.11
46 0.1
47 0.09
48 0.08
49 0.07
50 0.06
51 0.06
52 0.06
53 0.06
54 0.05
55 0.06
56 0.07
57 0.07
58 0.07
59 0.07
60 0.11
61 0.12
62 0.12
63 0.14
64 0.19
65 0.25
66 0.26
67 0.27
68 0.23
69 0.25
70 0.26
71 0.26
72 0.22
73 0.19
74 0.18
75 0.17
76 0.21
77 0.22
78 0.21
79 0.25
80 0.33
81 0.4
82 0.49
83 0.59
84 0.65
85 0.74
86 0.84
87 0.89
88 0.91
89 0.92
90 0.93
91 0.94
92 0.92
93 0.89
94 0.89
95 0.87
96 0.81
97 0.75
98 0.7
99 0.69
100 0.67
101 0.62
102 0.54
103 0.51
104 0.52
105 0.57