Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A512UHA8

Protein Details
Accession A0A512UHA8    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-54YYTPKRVKPKGVVKPKRELKPKRELKPKRELKPKRELKPKRELKPKRESNPVSBasic
NLS Segment(s)
PositionSequence
6-49KRVKPKGVVKPKRELKPKRELKPKRELKPKRELKPKRELKPKRE
Subcellular Location(s) nucl 22, mito 5
Family & Domain DBs
Amino Acid Sequences MYYTPKRVKPKGVVKPKRELKPKRELKPKRELKPKRELKPKRELKPKRESNPVSDNAKRPGLTEEEMQIEELN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.84
4 0.83
5 0.83
6 0.82
7 0.79
8 0.79
9 0.83
10 0.82
11 0.84
12 0.84
13 0.81
14 0.83
15 0.85
16 0.83
17 0.85
18 0.84
19 0.81
20 0.83
21 0.85
22 0.83
23 0.85
24 0.84
25 0.81
26 0.83
27 0.85
28 0.83
29 0.85
30 0.84
31 0.82
32 0.84
33 0.86
34 0.81
35 0.82
36 0.75
37 0.71
38 0.7
39 0.67
40 0.63
41 0.58
42 0.56
43 0.51
44 0.52
45 0.45
46 0.38
47 0.36
48 0.33
49 0.31
50 0.29
51 0.27
52 0.26
53 0.26