Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LDE9

Protein Details
Accession E2LDE9   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
274-293ASQPDNKKKSCNKLANYSYSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25, mito_nucl 13.833, cyto_nucl 13.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR003734  DUF155  
Gene Ontology GO:0005739  C:mitochondrion  
KEGG mpr:MPER_04299  -  
Pfam View protein in Pfam  
PF02582  DUF155  
Amino Acid Sequences ARQRPPNNAKKNCNSPMEQLPPHVNEIQIRENLSRCKTKYPSFLKEQRVVTPTSLTKKKAQSVHIGAAYAPARHPSSLRMTNVIKFLNAPRAAYGTNVRLINDVLYSPYSYQGPSIDDAPNSGSHVGHEMRTVKKKSKFEASSNEAEIFLFEYGTVVIWGMSEAQEKRFLSSLKRFEVEKLAPEDVEMEDLNYYYANYSRIYNDVITLRKGSSYMRGLSLSHALSQSVKISLFEKLISNTIEETKDIPEIIRETGKIGMPHKGAVETVSPIMMASQPDNKKKSCNKLANYSYSEPTSTPLVPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.7
3 0.69
4 0.68
5 0.6
6 0.55
7 0.54
8 0.49
9 0.49
10 0.45
11 0.37
12 0.32
13 0.35
14 0.36
15 0.32
16 0.33
17 0.32
18 0.35
19 0.4
20 0.42
21 0.45
22 0.42
23 0.48
24 0.52
25 0.56
26 0.62
27 0.64
28 0.66
29 0.68
30 0.74
31 0.73
32 0.74
33 0.69
34 0.65
35 0.59
36 0.53
37 0.45
38 0.42
39 0.39
40 0.41
41 0.43
42 0.4
43 0.45
44 0.49
45 0.55
46 0.55
47 0.54
48 0.55
49 0.55
50 0.58
51 0.51
52 0.45
53 0.38
54 0.36
55 0.33
56 0.24
57 0.19
58 0.16
59 0.16
60 0.16
61 0.17
62 0.17
63 0.24
64 0.29
65 0.3
66 0.33
67 0.34
68 0.36
69 0.39
70 0.36
71 0.28
72 0.24
73 0.24
74 0.27
75 0.26
76 0.23
77 0.2
78 0.22
79 0.21
80 0.21
81 0.22
82 0.16
83 0.2
84 0.2
85 0.19
86 0.18
87 0.18
88 0.17
89 0.14
90 0.12
91 0.08
92 0.08
93 0.09
94 0.08
95 0.09
96 0.09
97 0.09
98 0.09
99 0.09
100 0.1
101 0.1
102 0.13
103 0.13
104 0.12
105 0.13
106 0.13
107 0.12
108 0.12
109 0.12
110 0.09
111 0.08
112 0.11
113 0.11
114 0.1
115 0.12
116 0.15
117 0.19
118 0.27
119 0.3
120 0.34
121 0.41
122 0.45
123 0.46
124 0.53
125 0.52
126 0.5
127 0.55
128 0.53
129 0.48
130 0.45
131 0.42
132 0.32
133 0.27
134 0.22
135 0.15
136 0.09
137 0.06
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.03
144 0.03
145 0.03
146 0.03
147 0.03
148 0.04
149 0.06
150 0.07
151 0.08
152 0.13
153 0.13
154 0.14
155 0.17
156 0.17
157 0.2
158 0.28
159 0.32
160 0.3
161 0.31
162 0.31
163 0.3
164 0.35
165 0.31
166 0.27
167 0.25
168 0.23
169 0.21
170 0.21
171 0.2
172 0.14
173 0.14
174 0.1
175 0.07
176 0.06
177 0.07
178 0.07
179 0.05
180 0.05
181 0.04
182 0.06
183 0.07
184 0.08
185 0.09
186 0.1
187 0.12
188 0.13
189 0.13
190 0.14
191 0.17
192 0.18
193 0.18
194 0.18
195 0.17
196 0.16
197 0.16
198 0.15
199 0.17
200 0.19
201 0.19
202 0.2
203 0.21
204 0.21
205 0.22
206 0.25
207 0.19
208 0.17
209 0.16
210 0.15
211 0.14
212 0.15
213 0.14
214 0.12
215 0.12
216 0.11
217 0.12
218 0.13
219 0.14
220 0.14
221 0.14
222 0.14
223 0.17
224 0.16
225 0.16
226 0.16
227 0.18
228 0.17
229 0.16
230 0.16
231 0.15
232 0.15
233 0.15
234 0.13
235 0.13
236 0.14
237 0.16
238 0.17
239 0.16
240 0.16
241 0.19
242 0.22
243 0.23
244 0.23
245 0.27
246 0.26
247 0.27
248 0.26
249 0.24
250 0.21
251 0.19
252 0.2
253 0.15
254 0.15
255 0.13
256 0.12
257 0.11
258 0.11
259 0.11
260 0.11
261 0.12
262 0.2
263 0.28
264 0.36
265 0.41
266 0.42
267 0.5
268 0.58
269 0.66
270 0.68
271 0.7
272 0.69
273 0.75
274 0.81
275 0.8
276 0.78
277 0.72
278 0.65
279 0.57
280 0.52
281 0.41
282 0.36
283 0.32