Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A512UEZ7

Protein Details
Accession A0A512UEZ7    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
388-425EQETNQHQHQQKQNKEQKKKHKKKQKKVAFPNILHGPRHydrophilic
NLS Segment(s)
PositionSequence
402-415KEQKKKHKKKQKKV
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029052  Metallo-depent_PP-like  
Amino Acid Sequences MSTENRPIDAESSMKVVRVAVEGCCHGQLNKIYQSVPKNAELLIICGDFQAIRNQQDLKSMNVPAKYREMGDFPDYYSGKKRAPIMTIFIGGNHESSSYMRELQYGGWVAPDIYYLGEYGTIWYKGMRISGLSGIHSYPSFVSAKSNNPPVYTLPYGNSAIRSIYHIKPKNFLKLLLSGSSNIVLSHDWPKGIWDWGNKERLLKNKPFLKADMESGHFGSPLASQALEYLRPANWFSSHMHTFFDATVKHKDVEEKEEKEGEAEGLEDINDAKRRKTSGEAEATKEATKEDNNEISLDMDDMDDMSEMDNDQKIAGISPKSPTKNNNEISLDMDEELEPEKSANQENLQIPPKEVPPSVSEVSEVSEVSKASDTNKSESKNEATTSKEQETNQHQHQQKQNKEQKKKHKKKQKKVAFPNILHGPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.18
4 0.17
5 0.18
6 0.18
7 0.15
8 0.18
9 0.2
10 0.21
11 0.22
12 0.21
13 0.18
14 0.23
15 0.27
16 0.3
17 0.34
18 0.35
19 0.35
20 0.4
21 0.45
22 0.47
23 0.46
24 0.41
25 0.37
26 0.34
27 0.37
28 0.32
29 0.28
30 0.23
31 0.19
32 0.16
33 0.15
34 0.15
35 0.11
36 0.12
37 0.18
38 0.19
39 0.21
40 0.25
41 0.27
42 0.28
43 0.36
44 0.36
45 0.33
46 0.33
47 0.34
48 0.35
49 0.37
50 0.38
51 0.34
52 0.38
53 0.34
54 0.31
55 0.3
56 0.29
57 0.28
58 0.3
59 0.27
60 0.23
61 0.29
62 0.27
63 0.27
64 0.32
65 0.32
66 0.31
67 0.34
68 0.39
69 0.35
70 0.39
71 0.4
72 0.39
73 0.37
74 0.37
75 0.33
76 0.28
77 0.26
78 0.22
79 0.19
80 0.14
81 0.11
82 0.09
83 0.1
84 0.12
85 0.12
86 0.14
87 0.14
88 0.14
89 0.15
90 0.14
91 0.18
92 0.16
93 0.14
94 0.12
95 0.12
96 0.11
97 0.1
98 0.1
99 0.06
100 0.05
101 0.06
102 0.05
103 0.05
104 0.05
105 0.05
106 0.06
107 0.09
108 0.09
109 0.09
110 0.09
111 0.1
112 0.1
113 0.11
114 0.1
115 0.08
116 0.1
117 0.13
118 0.14
119 0.14
120 0.14
121 0.13
122 0.14
123 0.13
124 0.12
125 0.09
126 0.11
127 0.11
128 0.1
129 0.14
130 0.15
131 0.21
132 0.24
133 0.31
134 0.29
135 0.29
136 0.31
137 0.29
138 0.32
139 0.29
140 0.26
141 0.2
142 0.22
143 0.23
144 0.22
145 0.21
146 0.15
147 0.14
148 0.13
149 0.15
150 0.17
151 0.2
152 0.29
153 0.35
154 0.35
155 0.42
156 0.45
157 0.49
158 0.46
159 0.43
160 0.35
161 0.33
162 0.34
163 0.29
164 0.27
165 0.19
166 0.18
167 0.18
168 0.15
169 0.1
170 0.09
171 0.07
172 0.08
173 0.12
174 0.12
175 0.11
176 0.11
177 0.12
178 0.13
179 0.15
180 0.15
181 0.14
182 0.2
183 0.25
184 0.29
185 0.29
186 0.31
187 0.33
188 0.38
189 0.41
190 0.39
191 0.42
192 0.44
193 0.47
194 0.45
195 0.43
196 0.39
197 0.34
198 0.33
199 0.28
200 0.24
201 0.22
202 0.2
203 0.19
204 0.14
205 0.13
206 0.11
207 0.08
208 0.07
209 0.07
210 0.06
211 0.05
212 0.07
213 0.07
214 0.07
215 0.07
216 0.08
217 0.08
218 0.09
219 0.1
220 0.1
221 0.1
222 0.12
223 0.14
224 0.18
225 0.2
226 0.19
227 0.19
228 0.19
229 0.19
230 0.17
231 0.17
232 0.12
233 0.14
234 0.17
235 0.18
236 0.18
237 0.18
238 0.23
239 0.22
240 0.3
241 0.34
242 0.33
243 0.33
244 0.34
245 0.33
246 0.29
247 0.27
248 0.19
249 0.11
250 0.09
251 0.07
252 0.05
253 0.05
254 0.05
255 0.05
256 0.07
257 0.12
258 0.13
259 0.14
260 0.17
261 0.18
262 0.21
263 0.27
264 0.29
265 0.33
266 0.42
267 0.43
268 0.45
269 0.46
270 0.45
271 0.39
272 0.34
273 0.26
274 0.18
275 0.17
276 0.17
277 0.19
278 0.2
279 0.2
280 0.21
281 0.2
282 0.19
283 0.17
284 0.14
285 0.1
286 0.07
287 0.06
288 0.05
289 0.05
290 0.04
291 0.04
292 0.04
293 0.04
294 0.05
295 0.06
296 0.07
297 0.07
298 0.07
299 0.07
300 0.07
301 0.08
302 0.12
303 0.12
304 0.13
305 0.18
306 0.25
307 0.28
308 0.32
309 0.37
310 0.42
311 0.5
312 0.51
313 0.54
314 0.49
315 0.47
316 0.46
317 0.42
318 0.34
319 0.24
320 0.22
321 0.15
322 0.13
323 0.13
324 0.1
325 0.09
326 0.08
327 0.09
328 0.1
329 0.13
330 0.15
331 0.15
332 0.22
333 0.24
334 0.3
335 0.35
336 0.34
337 0.33
338 0.34
339 0.35
340 0.32
341 0.31
342 0.27
343 0.23
344 0.29
345 0.29
346 0.26
347 0.24
348 0.2
349 0.22
350 0.2
351 0.17
352 0.12
353 0.12
354 0.12
355 0.13
356 0.14
357 0.12
358 0.15
359 0.22
360 0.24
361 0.28
362 0.34
363 0.36
364 0.37
365 0.42
366 0.43
367 0.4
368 0.4
369 0.38
370 0.38
371 0.42
372 0.46
373 0.45
374 0.45
375 0.42
376 0.48
377 0.54
378 0.56
379 0.57
380 0.59
381 0.59
382 0.63
383 0.72
384 0.74
385 0.74
386 0.76
387 0.79
388 0.81
389 0.87
390 0.89
391 0.91
392 0.92
393 0.93
394 0.93
395 0.95
396 0.95
397 0.96
398 0.97
399 0.96
400 0.96
401 0.96
402 0.96
403 0.96
404 0.87
405 0.84