Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A512U8P3

Protein Details
Accession A0A512U8P3   
Localization Confidence High
Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
13-35VTAEEQKNLRKQRRVQERCFETPHydrophilic
151-170NPSFSRARSQKPKASFKKTEHydrophilic
NLS Segment(s)
PositionSequence
158-163RSQKPK
Subcellular Location(s) mito_nucl 13, nucl 24.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002483  PWI_dom  
IPR036483  PWI_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:1990904  C:ribonucleoprotein complex  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF01480  PWI  
PROSITE View protein in PROSITE  
PS51025  PWI  
Amino Acid Sequences MKVDVSVAEKQPVTAEEQKNLRKQRRVQERCFETPVNISKVSLPIIKQWLTDRLGEQLPDDDVAVEFIYELLIGGENDEPDIGAIREQMDDFLGKEKSRVFCLDLWQLLISAQSSPEGIPQKLVDERKKKIEEDEKARKEADVILRELRPNPSFSRARSQKPKASFKKTESKVTNVPPTMGNRVGKPSRKTNYNRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.34
4 0.42
5 0.49
6 0.56
7 0.65
8 0.67
9 0.66
10 0.72
11 0.75
12 0.79
13 0.81
14 0.82
15 0.82
16 0.82
17 0.78
18 0.76
19 0.66
20 0.57
21 0.54
22 0.51
23 0.45
24 0.37
25 0.31
26 0.27
27 0.28
28 0.28
29 0.24
30 0.19
31 0.19
32 0.24
33 0.24
34 0.24
35 0.25
36 0.28
37 0.28
38 0.28
39 0.24
40 0.23
41 0.23
42 0.22
43 0.2
44 0.15
45 0.14
46 0.13
47 0.12
48 0.08
49 0.07
50 0.07
51 0.06
52 0.05
53 0.04
54 0.04
55 0.04
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.04
62 0.05
63 0.05
64 0.05
65 0.05
66 0.04
67 0.04
68 0.05
69 0.04
70 0.04
71 0.04
72 0.05
73 0.05
74 0.06
75 0.06
76 0.05
77 0.06
78 0.06
79 0.09
80 0.09
81 0.09
82 0.1
83 0.13
84 0.14
85 0.15
86 0.16
87 0.15
88 0.15
89 0.19
90 0.21
91 0.18
92 0.17
93 0.16
94 0.14
95 0.12
96 0.11
97 0.08
98 0.05
99 0.05
100 0.05
101 0.05
102 0.05
103 0.09
104 0.12
105 0.12
106 0.13
107 0.13
108 0.15
109 0.2
110 0.26
111 0.3
112 0.35
113 0.38
114 0.46
115 0.49
116 0.47
117 0.5
118 0.54
119 0.54
120 0.56
121 0.64
122 0.59
123 0.59
124 0.58
125 0.49
126 0.41
127 0.38
128 0.35
129 0.28
130 0.27
131 0.28
132 0.3
133 0.31
134 0.32
135 0.33
136 0.27
137 0.27
138 0.27
139 0.31
140 0.33
141 0.35
142 0.44
143 0.45
144 0.54
145 0.61
146 0.66
147 0.66
148 0.72
149 0.79
150 0.78
151 0.81
152 0.8
153 0.76
154 0.79
155 0.76
156 0.77
157 0.71
158 0.68
159 0.65
160 0.65
161 0.67
162 0.57
163 0.54
164 0.48
165 0.48
166 0.47
167 0.46
168 0.41
169 0.34
170 0.42
171 0.49
172 0.52
173 0.54
174 0.58
175 0.6
176 0.67