Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A512ULW9

Protein Details
Accession A0A512ULW9   
Localization Confidence High
Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MAKSLRSKPKLRAKSVKRKGEFTKHydrophilic
68-93TTAAWKTSSKKKLSKAKKNRNKKLKFHydrophilic
NLS Segment(s)
PositionSequence
6-20RSKPKLRAKSVKRKG
75-93SSKKKLSKAKKNRNKKLKF
Subcellular Location(s) cyto_nucl 12, mito 4, nucl 20.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSLRSKPKLRAKSVKRKGEFTKFVDDRNARLAERTRLNLQKQNEEKMADAAPTEEVSEDATKKTPTTAAWKTSSKKKLSKAKKNRNKKLKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.89
3 0.9
4 0.83
5 0.81
6 0.8
7 0.79
8 0.75
9 0.68
10 0.69
11 0.59
12 0.57
13 0.58
14 0.51
15 0.42
16 0.41
17 0.39
18 0.28
19 0.3
20 0.32
21 0.28
22 0.31
23 0.32
24 0.32
25 0.36
26 0.4
27 0.42
28 0.41
29 0.44
30 0.44
31 0.44
32 0.4
33 0.35
34 0.31
35 0.27
36 0.25
37 0.16
38 0.13
39 0.1
40 0.08
41 0.07
42 0.07
43 0.05
44 0.05
45 0.07
46 0.08
47 0.08
48 0.09
49 0.11
50 0.11
51 0.12
52 0.12
53 0.13
54 0.13
55 0.21
56 0.26
57 0.3
58 0.34
59 0.41
60 0.45
61 0.53
62 0.59
63 0.59
64 0.61
65 0.65
66 0.7
67 0.75
68 0.81
69 0.83
70 0.86
71 0.89
72 0.93
73 0.95