Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A512UNG4

Protein Details
Accession A0A512UNG4    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
125-149KDISKDKSKDKSKDKTKLPKPSVKSBasic
NLS Segment(s)
PositionSequence
94-146PEKRHSLSRKLKSIFRKSKDEDAKAAAEKKSKDISKDKSKDKSKDKTKLPKPS
Subcellular Location(s) cyto 12cyto_nucl 12, nucl 8, mito 3, extr 1, pero 1, cysk 1, vacu 1
Family & Domain DBs
Amino Acid Sequences TEEKQPVSIPGVPVEAEPKAQELEHEAAEKAEKEALEKEEKEKTASGKFGVGAGVGVLAGAGAAAVAAVPHINGDKSASTSHATKGKTANSGEPEKRHSLSRKLKSIFRKSKDEDAKAAAEKKSKDISKDKSKDKSKDKTKLPKPSVKSVNVPKQPYGGAGAISKDSLVSIYEEVSDREYEQHKGDPDYIEVDAAVAEKLLKRHQDLIPKLRKGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.18
3 0.15
4 0.14
5 0.14
6 0.14
7 0.14
8 0.14
9 0.16
10 0.18
11 0.18
12 0.19
13 0.17
14 0.17
15 0.19
16 0.19
17 0.15
18 0.14
19 0.13
20 0.13
21 0.17
22 0.21
23 0.25
24 0.26
25 0.29
26 0.34
27 0.35
28 0.35
29 0.34
30 0.33
31 0.31
32 0.32
33 0.29
34 0.24
35 0.23
36 0.22
37 0.19
38 0.15
39 0.1
40 0.08
41 0.06
42 0.04
43 0.04
44 0.03
45 0.02
46 0.02
47 0.02
48 0.01
49 0.01
50 0.01
51 0.01
52 0.01
53 0.01
54 0.02
55 0.02
56 0.02
57 0.03
58 0.03
59 0.04
60 0.04
61 0.06
62 0.06
63 0.08
64 0.09
65 0.1
66 0.12
67 0.13
68 0.16
69 0.2
70 0.2
71 0.21
72 0.24
73 0.25
74 0.28
75 0.28
76 0.28
77 0.28
78 0.34
79 0.34
80 0.33
81 0.34
82 0.33
83 0.33
84 0.34
85 0.34
86 0.37
87 0.44
88 0.49
89 0.53
90 0.53
91 0.57
92 0.62
93 0.69
94 0.68
95 0.63
96 0.64
97 0.59
98 0.66
99 0.67
100 0.6
101 0.51
102 0.44
103 0.41
104 0.36
105 0.36
106 0.28
107 0.26
108 0.24
109 0.25
110 0.29
111 0.28
112 0.31
113 0.36
114 0.42
115 0.49
116 0.56
117 0.6
118 0.64
119 0.71
120 0.74
121 0.75
122 0.77
123 0.76
124 0.78
125 0.8
126 0.81
127 0.82
128 0.84
129 0.83
130 0.81
131 0.75
132 0.76
133 0.74
134 0.67
135 0.66
136 0.65
137 0.67
138 0.66
139 0.64
140 0.55
141 0.49
142 0.45
143 0.38
144 0.32
145 0.22
146 0.17
147 0.15
148 0.15
149 0.13
150 0.13
151 0.12
152 0.08
153 0.07
154 0.07
155 0.06
156 0.07
157 0.07
158 0.07
159 0.09
160 0.1
161 0.1
162 0.12
163 0.12
164 0.11
165 0.15
166 0.17
167 0.19
168 0.21
169 0.25
170 0.26
171 0.28
172 0.3
173 0.27
174 0.26
175 0.26
176 0.24
177 0.19
178 0.16
179 0.13
180 0.11
181 0.09
182 0.08
183 0.05
184 0.06
185 0.08
186 0.11
187 0.17
188 0.21
189 0.25
190 0.32
191 0.37
192 0.46
193 0.52
194 0.6
195 0.65