Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A512UNE0

Protein Details
Accession A0A512UNE0    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-34RRPKKRPRNWSRKRSLRRSKRRLKKLAEEKAAKEBasic
NLS Segment(s)
PositionSequence
1-53RRPKKRPRNWSRKRSLRRSKRRLKKLAEEKAAKEAEEKAAKEAEEKAAKEKKL
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences RRPKKRPRNWSRKRSLRRSKRRLKKLAEEKAAKEAEEKAAKEAEEKAAKEKKLAEEQKAKELDTSHHSADPEVTVVGHQLSGVNGSKSREISGLNAESPSAEFNGTEPVHRSLDPAVVATE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.95
3 0.95
4 0.95
5 0.95
6 0.95
7 0.95
8 0.95
9 0.93
10 0.91
11 0.9
12 0.9
13 0.89
14 0.88
15 0.82
16 0.73
17 0.71
18 0.63
19 0.52
20 0.42
21 0.34
22 0.31
23 0.3
24 0.28
25 0.22
26 0.23
27 0.23
28 0.23
29 0.23
30 0.23
31 0.23
32 0.23
33 0.28
34 0.32
35 0.32
36 0.32
37 0.33
38 0.31
39 0.36
40 0.4
41 0.39
42 0.42
43 0.44
44 0.49
45 0.47
46 0.43
47 0.34
48 0.31
49 0.27
50 0.23
51 0.24
52 0.18
53 0.19
54 0.19
55 0.18
56 0.17
57 0.15
58 0.11
59 0.08
60 0.07
61 0.05
62 0.05
63 0.05
64 0.05
65 0.04
66 0.04
67 0.04
68 0.07
69 0.08
70 0.09
71 0.11
72 0.12
73 0.15
74 0.15
75 0.16
76 0.15
77 0.15
78 0.16
79 0.2
80 0.21
81 0.19
82 0.19
83 0.18
84 0.17
85 0.16
86 0.15
87 0.1
88 0.08
89 0.07
90 0.08
91 0.16
92 0.16
93 0.17
94 0.19
95 0.22
96 0.24
97 0.24
98 0.26
99 0.2
100 0.23
101 0.22