Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A512U758

Protein Details
Accession A0A512U758    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MGKRKTAAKPVKKVKQKLDITFRCHydrophilic
NLS Segment(s)
PositionSequence
5-13KTAAKPVKK
Subcellular Location(s) nucl 10, cyto_nucl 9.5, mito 9, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKTAAKPVKKVKQKLDITFRCLFCNHEKSVICTMDKRNGIGDLHCKICGQSFQTAINSLSHPVDIYSDWIDACEDLAEDNEGAGPFEDGENSKDQYDYSDDEGAQPAKIRAVYSGDEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.83
4 0.82
5 0.82
6 0.77
7 0.74
8 0.73
9 0.65
10 0.57
11 0.49
12 0.44
13 0.41
14 0.41
15 0.36
16 0.36
17 0.35
18 0.37
19 0.43
20 0.42
21 0.35
22 0.33
23 0.35
24 0.36
25 0.36
26 0.32
27 0.26
28 0.26
29 0.25
30 0.23
31 0.25
32 0.2
33 0.21
34 0.2
35 0.19
36 0.17
37 0.17
38 0.17
39 0.14
40 0.14
41 0.14
42 0.15
43 0.16
44 0.17
45 0.16
46 0.15
47 0.13
48 0.12
49 0.11
50 0.09
51 0.08
52 0.07
53 0.07
54 0.06
55 0.08
56 0.08
57 0.08
58 0.08
59 0.08
60 0.08
61 0.07
62 0.07
63 0.05
64 0.04
65 0.04
66 0.04
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.06
73 0.06
74 0.05
75 0.05
76 0.05
77 0.07
78 0.07
79 0.09
80 0.12
81 0.13
82 0.13
83 0.13
84 0.13
85 0.15
86 0.17
87 0.18
88 0.19
89 0.2
90 0.2
91 0.21
92 0.24
93 0.23
94 0.2
95 0.19
96 0.16
97 0.16
98 0.17
99 0.17
100 0.16
101 0.19