Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A512UNK0

Protein Details
Accession A0A512UNK0    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
78-105QAKLDKLPKDKMKPKPKKKSTRTTNVIEHydrophilic
184-211PAPPTKTRPTKKEPVRGKRRSPRSTSEDBasic
NLS Segment(s)
PositionSequence
83-97KLPKDKMKPKPKKKS
189-206KTRPTKKEPVRGKRRSPR
Subcellular Location(s) nucl 21, cyto_nucl 12.333, mito_nucl 11.833, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000313  PWWP_dom  
Pfam View protein in Pfam  
PF00855  PWWP  
PROSITE View protein in PROSITE  
PS50812  PWWP  
Amino Acid Sequences MPPKKEKRLLYQPKDMVLAKMTGFPAWPSFVMPPETIPPSIMKAKKKTTNTCVIFIPDGDFNWMNEKSLEALSPEKLQAKLDKLPKDKMKPKPKKKSTRTTNVIEAFVAANGLQFDDFMADLKDGKESFDDEDFDDEDNEEEEEMVEEDASTINNPDPDNEESRDNQKEQKLGEPAEQQVPEVPAPPTKTRPTKKEPVRGKRRSPRSTSEDDADTESVEQDSSSSRKGLGSDDHITTDGENEDDKIADTKDDNGDVING
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.59
3 0.5
4 0.41
5 0.35
6 0.25
7 0.26
8 0.23
9 0.19
10 0.18
11 0.17
12 0.17
13 0.17
14 0.17
15 0.15
16 0.16
17 0.18
18 0.21
19 0.2
20 0.2
21 0.22
22 0.24
23 0.22
24 0.22
25 0.2
26 0.22
27 0.3
28 0.34
29 0.37
30 0.42
31 0.51
32 0.59
33 0.66
34 0.71
35 0.7
36 0.74
37 0.7
38 0.65
39 0.58
40 0.52
41 0.44
42 0.35
43 0.3
44 0.2
45 0.17
46 0.19
47 0.17
48 0.15
49 0.19
50 0.19
51 0.18
52 0.16
53 0.17
54 0.14
55 0.14
56 0.14
57 0.1
58 0.12
59 0.13
60 0.14
61 0.16
62 0.17
63 0.17
64 0.18
65 0.2
66 0.23
67 0.28
68 0.34
69 0.4
70 0.41
71 0.48
72 0.54
73 0.6
74 0.65
75 0.68
76 0.73
77 0.76
78 0.83
79 0.86
80 0.89
81 0.91
82 0.92
83 0.92
84 0.91
85 0.9
86 0.86
87 0.79
88 0.76
89 0.67
90 0.58
91 0.47
92 0.38
93 0.27
94 0.2
95 0.15
96 0.07
97 0.05
98 0.04
99 0.05
100 0.04
101 0.03
102 0.03
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.05
109 0.05
110 0.07
111 0.07
112 0.07
113 0.07
114 0.08
115 0.09
116 0.1
117 0.1
118 0.09
119 0.1
120 0.11
121 0.1
122 0.1
123 0.08
124 0.07
125 0.07
126 0.06
127 0.05
128 0.04
129 0.04
130 0.04
131 0.04
132 0.04
133 0.04
134 0.03
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.05
141 0.07
142 0.07
143 0.08
144 0.12
145 0.14
146 0.18
147 0.19
148 0.2
149 0.2
150 0.26
151 0.29
152 0.27
153 0.3
154 0.29
155 0.3
156 0.29
157 0.33
158 0.32
159 0.3
160 0.33
161 0.3
162 0.29
163 0.31
164 0.3
165 0.24
166 0.22
167 0.22
168 0.18
169 0.17
170 0.16
171 0.14
172 0.19
173 0.22
174 0.26
175 0.32
176 0.42
177 0.47
178 0.55
179 0.6
180 0.66
181 0.72
182 0.77
183 0.8
184 0.81
185 0.85
186 0.86
187 0.88
188 0.88
189 0.9
190 0.88
191 0.85
192 0.82
193 0.78
194 0.76
195 0.7
196 0.64
197 0.55
198 0.48
199 0.44
200 0.35
201 0.28
202 0.21
203 0.17
204 0.13
205 0.11
206 0.09
207 0.06
208 0.1
209 0.12
210 0.13
211 0.13
212 0.14
213 0.15
214 0.16
215 0.19
216 0.21
217 0.25
218 0.28
219 0.29
220 0.3
221 0.29
222 0.28
223 0.25
224 0.22
225 0.16
226 0.13
227 0.12
228 0.11
229 0.11
230 0.11
231 0.12
232 0.13
233 0.13
234 0.14
235 0.14
236 0.18
237 0.21
238 0.21
239 0.2