Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A512UG57

Protein Details
Accession A0A512UG57    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
62-88DEGKTKSYWKTKKRRWGFNHKFNRQSAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MKVEKFQRVSPNETREPDEVVDDLTVTGSVILEASRARDNSNPDGITDSIKSFPKGVPNEVDEGKTKSYWKTKKRRWGFNHKFNRQSAQLYWRIIMVRMGSSNQSTEKYYSVLLARSTKTYQGNGNQDEIWGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.51
3 0.5
4 0.42
5 0.36
6 0.28
7 0.21
8 0.18
9 0.14
10 0.12
11 0.09
12 0.08
13 0.06
14 0.05
15 0.04
16 0.04
17 0.04
18 0.04
19 0.04
20 0.05
21 0.07
22 0.1
23 0.11
24 0.12
25 0.16
26 0.21
27 0.25
28 0.29
29 0.27
30 0.24
31 0.27
32 0.26
33 0.24
34 0.2
35 0.17
36 0.15
37 0.16
38 0.16
39 0.15
40 0.15
41 0.21
42 0.22
43 0.23
44 0.22
45 0.23
46 0.25
47 0.25
48 0.25
49 0.19
50 0.19
51 0.18
52 0.16
53 0.16
54 0.17
55 0.25
56 0.32
57 0.41
58 0.5
59 0.57
60 0.67
61 0.75
62 0.81
63 0.81
64 0.84
65 0.85
66 0.84
67 0.87
68 0.84
69 0.81
70 0.72
71 0.68
72 0.59
73 0.52
74 0.45
75 0.41
76 0.39
77 0.33
78 0.32
79 0.29
80 0.26
81 0.23
82 0.22
83 0.16
84 0.13
85 0.13
86 0.14
87 0.14
88 0.14
89 0.16
90 0.16
91 0.17
92 0.17
93 0.18
94 0.18
95 0.17
96 0.17
97 0.18
98 0.18
99 0.18
100 0.2
101 0.23
102 0.23
103 0.26
104 0.28
105 0.31
106 0.32
107 0.33
108 0.36
109 0.4
110 0.48
111 0.46
112 0.47
113 0.42