Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A512UI99

Protein Details
Accession A0A512UI99    Localization Confidence Low Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
101-126EFKGGRPEIRHQRDRRFKQEIKLPKNBasic
NLS Segment(s)
Subcellular Location(s) mito 24, nucl 1, cyto 1, cyto_nucl 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR040008  MRPL46  
IPR021757  Ribosomal_L46_N  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
Pfam View protein in Pfam  
PF11788  MRP-L46  
Amino Acid Sequences MKIVLFGCNKTMFKQGFIRWNSTAATNSAVKIQSTLLLSRIPVVTADLPVFQQQYYKYQNELWRRLMWTFPKWFYFKEGTLSEQRYRELNKDPVFNNPNLEFKGGRPEIRHQRDRRFKQEIKLPKNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.41
3 0.44
4 0.46
5 0.5
6 0.42
7 0.43
8 0.4
9 0.35
10 0.3
11 0.23
12 0.23
13 0.18
14 0.17
15 0.19
16 0.19
17 0.17
18 0.16
19 0.15
20 0.14
21 0.14
22 0.15
23 0.12
24 0.12
25 0.12
26 0.13
27 0.13
28 0.1
29 0.09
30 0.1
31 0.09
32 0.09
33 0.1
34 0.08
35 0.09
36 0.1
37 0.1
38 0.08
39 0.1
40 0.1
41 0.15
42 0.2
43 0.2
44 0.21
45 0.24
46 0.31
47 0.37
48 0.4
49 0.37
50 0.34
51 0.35
52 0.34
53 0.34
54 0.31
55 0.29
56 0.28
57 0.27
58 0.3
59 0.3
60 0.3
61 0.3
62 0.3
63 0.25
64 0.26
65 0.25
66 0.25
67 0.29
68 0.33
69 0.32
70 0.3
71 0.31
72 0.29
73 0.3
74 0.3
75 0.32
76 0.36
77 0.35
78 0.39
79 0.39
80 0.45
81 0.47
82 0.44
83 0.42
84 0.36
85 0.36
86 0.32
87 0.34
88 0.25
89 0.22
90 0.31
91 0.29
92 0.3
93 0.3
94 0.38
95 0.47
96 0.56
97 0.65
98 0.63
99 0.71
100 0.79
101 0.85
102 0.84
103 0.84
104 0.8
105 0.79
106 0.81
107 0.8