Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A512UHU1

Protein Details
Accession A0A512UHU1   
Localization Confidence High
Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-34MSEPTPQPSQPVKRKRGRPPKANKPEDAFPHydrophilic
68-93TPVMKVMPSPHRKKRRKSSHFSSPLDHydrophilic
NLS Segment(s)
PositionSequence
17-28KRKRGRPPKANK
78-84HRKKRRK
Subcellular Location(s) cyto_nucl 11.333, mito 5.5, mito_nucl 12.333, nucl 18
Family & Domain DBs
Amino Acid Sequences MSLLMSEPTPQPSQPVKRKRGRPPKANKPEDAFPTFTMQLQSSPLSGSPNAERTSSQVVRIGEPDSFTPVMKVMPSPHRKKRRKSSHFSSPLDPPRFPSIEELSTPIVKPGIASSGSNKLHSRGLDKLSIMVNNVTNVAAHLNTPPDSVLRPGFSLSSGDLSESLKEKSCLPEAQVRRHKHSSGSPHLFEKDTGYHMHNSTPISEPISESAWGSDSTY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.59
3 0.64
4 0.72
5 0.82
6 0.87
7 0.89
8 0.89
9 0.9
10 0.9
11 0.91
12 0.93
13 0.9
14 0.85
15 0.8
16 0.77
17 0.73
18 0.66
19 0.58
20 0.48
21 0.46
22 0.41
23 0.35
24 0.3
25 0.24
26 0.2
27 0.2
28 0.19
29 0.14
30 0.14
31 0.13
32 0.14
33 0.14
34 0.16
35 0.16
36 0.21
37 0.21
38 0.21
39 0.21
40 0.22
41 0.3
42 0.29
43 0.27
44 0.26
45 0.26
46 0.27
47 0.28
48 0.25
49 0.17
50 0.17
51 0.16
52 0.15
53 0.15
54 0.14
55 0.12
56 0.12
57 0.12
58 0.11
59 0.12
60 0.12
61 0.22
62 0.31
63 0.39
64 0.49
65 0.6
66 0.68
67 0.77
68 0.83
69 0.85
70 0.86
71 0.87
72 0.85
73 0.85
74 0.86
75 0.79
76 0.71
77 0.68
78 0.67
79 0.61
80 0.53
81 0.44
82 0.4
83 0.37
84 0.34
85 0.3
86 0.24
87 0.21
88 0.22
89 0.21
90 0.18
91 0.18
92 0.17
93 0.13
94 0.1
95 0.08
96 0.08
97 0.06
98 0.07
99 0.07
100 0.07
101 0.09
102 0.17
103 0.18
104 0.2
105 0.2
106 0.2
107 0.22
108 0.22
109 0.23
110 0.19
111 0.21
112 0.21
113 0.2
114 0.21
115 0.19
116 0.19
117 0.17
118 0.14
119 0.12
120 0.11
121 0.11
122 0.09
123 0.07
124 0.07
125 0.07
126 0.06
127 0.06
128 0.07
129 0.08
130 0.08
131 0.09
132 0.09
133 0.09
134 0.1
135 0.12
136 0.12
137 0.12
138 0.12
139 0.12
140 0.12
141 0.12
142 0.13
143 0.11
144 0.11
145 0.1
146 0.1
147 0.1
148 0.1
149 0.12
150 0.12
151 0.13
152 0.13
153 0.14
154 0.15
155 0.18
156 0.22
157 0.22
158 0.23
159 0.31
160 0.35
161 0.45
162 0.53
163 0.54
164 0.58
165 0.63
166 0.61
167 0.57
168 0.59
169 0.58
170 0.6
171 0.62
172 0.57
173 0.55
174 0.56
175 0.52
176 0.45
177 0.39
178 0.31
179 0.26
180 0.26
181 0.25
182 0.27
183 0.26
184 0.28
185 0.27
186 0.25
187 0.26
188 0.26
189 0.25
190 0.23
191 0.23
192 0.23
193 0.22
194 0.23
195 0.21
196 0.17
197 0.17
198 0.15