Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A512UDM8

Protein Details
Accession A0A512UDM8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
71-102AELKEQNPMKWRKKQNAKRNTAKIKNNNFLSQHydrophilic
NLS Segment(s)
PositionSequence
82-89RKKQNAKR
Subcellular Location(s) mito 24, mito_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLRFPAGIFRFGSARNLSSSFPRLNVPKSSCAPGTVLNLKVRKNGDEPVALEDHEYPEWLWDILDKSKSEAELKEQNPMKWRKKQNAKRNTAKIKNNNFLSQM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.24
4 0.23
5 0.26
6 0.3
7 0.26
8 0.25
9 0.28
10 0.28
11 0.31
12 0.37
13 0.36
14 0.37
15 0.38
16 0.41
17 0.36
18 0.34
19 0.31
20 0.26
21 0.27
22 0.25
23 0.26
24 0.28
25 0.31
26 0.3
27 0.33
28 0.32
29 0.29
30 0.27
31 0.27
32 0.24
33 0.23
34 0.23
35 0.21
36 0.2
37 0.17
38 0.15
39 0.13
40 0.12
41 0.1
42 0.09
43 0.07
44 0.07
45 0.07
46 0.07
47 0.06
48 0.06
49 0.08
50 0.11
51 0.13
52 0.13
53 0.15
54 0.16
55 0.17
56 0.18
57 0.17
58 0.2
59 0.26
60 0.27
61 0.34
62 0.36
63 0.37
64 0.44
65 0.52
66 0.55
67 0.56
68 0.65
69 0.67
70 0.75
71 0.83
72 0.85
73 0.87
74 0.89
75 0.9
76 0.91
77 0.91
78 0.89
79 0.89
80 0.89
81 0.88
82 0.88
83 0.83