Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A512U6H8

Protein Details
Accession A0A512U6H8   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
6-38YSLAKEVRKNEQKSKQKIQSRQKHQSKIEQLSSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 2.5, cyto_nucl 13.5, nucl 21.5
Family & Domain DBs
Pfam View protein in Pfam  
PF12622  NpwBP  
Amino Acid Sequences MIRGNYSLAKEVRKNEQKSKQKIQSRQKHQSKIEQLSSADPIRLFFQVEKLEKIVDPDPHQQKRLSKLRQDWAFIQKNKLHNEKVSAFLENRQKVKDAREKEQRKLRGKDSVYFNPELNPLGKVPDTSNMAQDYTSLPNIPKPVRSFHTYEQDPLILKLNIKPPQGSPPKFYKNVQNIQRKTYNPSENPQEPVSKTCRLPTDYKSTNLDTDSNYESHSDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.64
3 0.71
4 0.74
5 0.79
6 0.85
7 0.84
8 0.84
9 0.87
10 0.87
11 0.88
12 0.88
13 0.9
14 0.89
15 0.88
16 0.85
17 0.85
18 0.84
19 0.81
20 0.75
21 0.67
22 0.59
23 0.52
24 0.5
25 0.41
26 0.33
27 0.25
28 0.21
29 0.19
30 0.18
31 0.17
32 0.13
33 0.17
34 0.23
35 0.25
36 0.26
37 0.24
38 0.25
39 0.24
40 0.27
41 0.26
42 0.23
43 0.26
44 0.33
45 0.42
46 0.44
47 0.47
48 0.47
49 0.49
50 0.54
51 0.59
52 0.57
53 0.56
54 0.59
55 0.66
56 0.66
57 0.64
58 0.59
59 0.59
60 0.6
61 0.54
62 0.53
63 0.48
64 0.51
65 0.53
66 0.54
67 0.47
68 0.4
69 0.44
70 0.39
71 0.39
72 0.34
73 0.31
74 0.25
75 0.28
76 0.35
77 0.33
78 0.33
79 0.29
80 0.3
81 0.3
82 0.37
83 0.39
84 0.36
85 0.4
86 0.49
87 0.53
88 0.59
89 0.65
90 0.67
91 0.67
92 0.67
93 0.62
94 0.6
95 0.57
96 0.56
97 0.54
98 0.51
99 0.46
100 0.43
101 0.4
102 0.32
103 0.31
104 0.25
105 0.19
106 0.14
107 0.1
108 0.1
109 0.1
110 0.1
111 0.1
112 0.12
113 0.15
114 0.15
115 0.17
116 0.16
117 0.16
118 0.15
119 0.15
120 0.14
121 0.12
122 0.12
123 0.11
124 0.1
125 0.12
126 0.17
127 0.18
128 0.2
129 0.2
130 0.24
131 0.27
132 0.31
133 0.34
134 0.35
135 0.43
136 0.4
137 0.39
138 0.36
139 0.34
140 0.31
141 0.27
142 0.26
143 0.17
144 0.17
145 0.19
146 0.26
147 0.29
148 0.3
149 0.31
150 0.28
151 0.38
152 0.47
153 0.45
154 0.43
155 0.47
156 0.53
157 0.55
158 0.56
159 0.56
160 0.56
161 0.62
162 0.67
163 0.68
164 0.63
165 0.66
166 0.71
167 0.63
168 0.6
169 0.6
170 0.6
171 0.54
172 0.57
173 0.59
174 0.55
175 0.58
176 0.54
177 0.49
178 0.42
179 0.43
180 0.42
181 0.39
182 0.37
183 0.39
184 0.42
185 0.42
186 0.45
187 0.46
188 0.51
189 0.5
190 0.53
191 0.53
192 0.5
193 0.48
194 0.45
195 0.41
196 0.33
197 0.33
198 0.31
199 0.27
200 0.25