Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A512U6F5

Protein Details
Accession A0A512U6F5    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
107-132IAQKMHAKKVDRLRKKEKRNKLLRERBasic
NLS Segment(s)
PositionSequence
39-52KKDAFRLKSAGVRK
79-132EKADEKNKKIEIIKQRREAIAEKERYEKIAQKMHAKKVDRLRKKEKRNKLLRER
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSATSEKEFKDIPKKYIDPLVEKDEGEGSRVNGKDWKIKKDAFRLKSAGVRKINTWKLREEKKLQNDQFKQRINSLKQEKADEKNKKIEIIKQRREAIAEKERYEKIAQKMHAKKVDRLRKKEKRNKLLRER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.47
3 0.52
4 0.5
5 0.45
6 0.45
7 0.48
8 0.41
9 0.39
10 0.36
11 0.34
12 0.29
13 0.25
14 0.21
15 0.16
16 0.21
17 0.21
18 0.21
19 0.21
20 0.23
21 0.3
22 0.34
23 0.39
24 0.38
25 0.43
26 0.48
27 0.55
28 0.62
29 0.57
30 0.57
31 0.54
32 0.5
33 0.52
34 0.5
35 0.48
36 0.42
37 0.4
38 0.37
39 0.43
40 0.49
41 0.47
42 0.45
43 0.43
44 0.46
45 0.52
46 0.55
47 0.54
48 0.54
49 0.57
50 0.65
51 0.63
52 0.65
53 0.64
54 0.66
55 0.66
56 0.62
57 0.55
58 0.5
59 0.54
60 0.47
61 0.51
62 0.49
63 0.46
64 0.44
65 0.48
66 0.47
67 0.47
68 0.54
69 0.53
70 0.51
71 0.54
72 0.53
73 0.53
74 0.5
75 0.51
76 0.52
77 0.55
78 0.59
79 0.58
80 0.6
81 0.57
82 0.58
83 0.53
84 0.51
85 0.49
86 0.46
87 0.41
88 0.43
89 0.43
90 0.43
91 0.42
92 0.41
93 0.38
94 0.4
95 0.42
96 0.47
97 0.55
98 0.61
99 0.66
100 0.63
101 0.64
102 0.67
103 0.74
104 0.74
105 0.76
106 0.78
107 0.81
108 0.88
109 0.91
110 0.91
111 0.91
112 0.92