Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A512UG39

Protein Details
Accession A0A512UG39   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
95-122RIYNRVKELKIKNSKREKKKKESDAFRQBasic
NLS Segment(s)
PositionSequence
102-116ELKIKNSKREKKKKE
Subcellular Location(s) cyto 9, mito 3, nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR021988  BMT1  
Gene Ontology GO:0000030  F:mannosyltransferase activity  
Pfam View protein in Pfam  
PF12141  BMT  
Amino Acid Sequences MLPVPFYHDYAQPDMKYLGPEDPRLILVRNKDGHEEPALIYNSYHQKKASVDDDEDGVLVKEHMYFRSMWVSWGWQFQRGKFAVEDNHNPDFDNRIYNRVKELKIKNSKREKKKKESDAFRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.27
4 0.24
5 0.25
6 0.23
7 0.24
8 0.23
9 0.23
10 0.24
11 0.23
12 0.24
13 0.21
14 0.23
15 0.28
16 0.3
17 0.3
18 0.33
19 0.33
20 0.33
21 0.32
22 0.28
23 0.21
24 0.24
25 0.23
26 0.19
27 0.18
28 0.19
29 0.26
30 0.26
31 0.27
32 0.22
33 0.23
34 0.24
35 0.28
36 0.28
37 0.22
38 0.22
39 0.21
40 0.22
41 0.19
42 0.18
43 0.13
44 0.09
45 0.06
46 0.05
47 0.04
48 0.05
49 0.06
50 0.06
51 0.07
52 0.07
53 0.09
54 0.13
55 0.13
56 0.12
57 0.12
58 0.14
59 0.14
60 0.2
61 0.2
62 0.22
63 0.24
64 0.24
65 0.3
66 0.29
67 0.29
68 0.24
69 0.26
70 0.25
71 0.3
72 0.35
73 0.33
74 0.35
75 0.33
76 0.33
77 0.31
78 0.29
79 0.25
80 0.27
81 0.22
82 0.27
83 0.3
84 0.31
85 0.37
86 0.4
87 0.42
88 0.44
89 0.51
90 0.54
91 0.62
92 0.7
93 0.73
94 0.78
95 0.85
96 0.87
97 0.9
98 0.9
99 0.9
100 0.93
101 0.93
102 0.93