Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A512UDW7

Protein Details
Accession A0A512UDW7   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MSKSKNHTNHNQNKKAHKNGIKKPKTYRYRSLKNVDHydrophilic
NLS Segment(s)
PositionSequence
14-28KKAHKNGIKKPKTYR
Subcellular Location(s) mito 11, mito_nucl 13.5, nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MSKSKNHTNHNQNKKAHKNGIKKPKTYRYRSLKNVDAKFRRNHRYALQGTAKALAEGVWQKMWEWDNDGVCGAMRILLRPPSYYSCLYHSLC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.84
3 0.83
4 0.82
5 0.81
6 0.82
7 0.86
8 0.83
9 0.8
10 0.8
11 0.81
12 0.81
13 0.78
14 0.79
15 0.78
16 0.79
17 0.81
18 0.78
19 0.75
20 0.74
21 0.73
22 0.72
23 0.68
24 0.64
25 0.63
26 0.65
27 0.64
28 0.57
29 0.55
30 0.48
31 0.5
32 0.46
33 0.46
34 0.42
35 0.35
36 0.33
37 0.32
38 0.29
39 0.2
40 0.18
41 0.11
42 0.09
43 0.1
44 0.11
45 0.09
46 0.09
47 0.1
48 0.13
49 0.14
50 0.13
51 0.16
52 0.18
53 0.18
54 0.19
55 0.19
56 0.15
57 0.14
58 0.14
59 0.09
60 0.09
61 0.08
62 0.09
63 0.13
64 0.18
65 0.19
66 0.21
67 0.25
68 0.27
69 0.32
70 0.34
71 0.33
72 0.32