Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A512U9U4

Protein Details
Accession A0A512U9U4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
328-353SSLNPMYHIKNKKKHELSKAERDALFHydrophilic
NLS Segment(s)
PositionSequence
129-136TPKGSKKR
Subcellular Location(s) plas 20, E.R. 4, mito 1, extr 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR004923  FTR1/Fip1/EfeU  
Gene Ontology GO:0033573  C:high-affinity iron permease complex  
GO:0005381  F:iron ion transmembrane transporter activity  
Pfam View protein in Pfam  
PF03239  FTR1  
Amino Acid Sequences MVNVFNVQIFFVVLRESLEAVVVVSVLLAFLKQGLGGATDDPVVYKRLRKQVWFGAILGVVICLCIGAAFIAVFYTLKNDIWGKSEDLWEGIFCLIATIMITFMGLAMLRINKMREKWRVKLAQALVKTPKGSKKRLGLGHFTKKYSMFILPFVTTLREGLEAVVFVGGVGLNSPASSFPIPVICGLIAGILVGVIMYYSGANFSLQIFLIVSTCVLYLISAGLFSRAVWGFEQYIYNKQTGGDAAENGSGPGTYNIRLSVWHVNCCNPEKDSGWDVFNSLLGWQNSATYGSVISYNIYWLFIIVTVFLMGYEEKHGHLPFLKNVTLSSLNPMYHIKNKKKHELSKAERDALFEKVRKQNLGQDETSTDSVAHKAEKISESESN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.1
4 0.09
5 0.1
6 0.09
7 0.08
8 0.08
9 0.07
10 0.05
11 0.04
12 0.04
13 0.04
14 0.04
15 0.03
16 0.03
17 0.04
18 0.04
19 0.04
20 0.05
21 0.05
22 0.07
23 0.08
24 0.08
25 0.09
26 0.09
27 0.09
28 0.1
29 0.11
30 0.12
31 0.14
32 0.2
33 0.27
34 0.36
35 0.42
36 0.45
37 0.52
38 0.58
39 0.63
40 0.58
41 0.51
42 0.43
43 0.38
44 0.34
45 0.26
46 0.17
47 0.1
48 0.07
49 0.06
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.04
59 0.04
60 0.04
61 0.04
62 0.07
63 0.08
64 0.08
65 0.11
66 0.13
67 0.14
68 0.18
69 0.2
70 0.2
71 0.21
72 0.23
73 0.21
74 0.19
75 0.19
76 0.15
77 0.14
78 0.11
79 0.09
80 0.07
81 0.06
82 0.05
83 0.05
84 0.05
85 0.04
86 0.04
87 0.04
88 0.04
89 0.03
90 0.03
91 0.04
92 0.03
93 0.03
94 0.05
95 0.06
96 0.07
97 0.09
98 0.11
99 0.15
100 0.19
101 0.27
102 0.36
103 0.42
104 0.46
105 0.54
106 0.59
107 0.56
108 0.6
109 0.57
110 0.53
111 0.47
112 0.48
113 0.42
114 0.38
115 0.38
116 0.34
117 0.38
118 0.38
119 0.42
120 0.44
121 0.47
122 0.53
123 0.58
124 0.58
125 0.59
126 0.61
127 0.66
128 0.63
129 0.57
130 0.51
131 0.45
132 0.42
133 0.35
134 0.29
135 0.19
136 0.18
137 0.19
138 0.17
139 0.17
140 0.16
141 0.15
142 0.11
143 0.11
144 0.1
145 0.08
146 0.07
147 0.07
148 0.07
149 0.06
150 0.06
151 0.05
152 0.04
153 0.03
154 0.03
155 0.03
156 0.02
157 0.03
158 0.03
159 0.03
160 0.03
161 0.03
162 0.03
163 0.05
164 0.06
165 0.06
166 0.06
167 0.07
168 0.08
169 0.08
170 0.08
171 0.06
172 0.06
173 0.05
174 0.05
175 0.04
176 0.03
177 0.03
178 0.02
179 0.02
180 0.02
181 0.01
182 0.01
183 0.01
184 0.02
185 0.02
186 0.02
187 0.02
188 0.03
189 0.03
190 0.04
191 0.04
192 0.05
193 0.05
194 0.05
195 0.05
196 0.05
197 0.05
198 0.05
199 0.05
200 0.04
201 0.04
202 0.04
203 0.04
204 0.03
205 0.03
206 0.03
207 0.03
208 0.03
209 0.03
210 0.04
211 0.04
212 0.04
213 0.07
214 0.07
215 0.08
216 0.08
217 0.1
218 0.1
219 0.11
220 0.14
221 0.12
222 0.18
223 0.18
224 0.18
225 0.17
226 0.16
227 0.16
228 0.14
229 0.16
230 0.11
231 0.1
232 0.11
233 0.11
234 0.11
235 0.1
236 0.09
237 0.06
238 0.06
239 0.07
240 0.08
241 0.08
242 0.08
243 0.09
244 0.09
245 0.1
246 0.13
247 0.21
248 0.22
249 0.26
250 0.26
251 0.29
252 0.33
253 0.36
254 0.35
255 0.26
256 0.27
257 0.25
258 0.28
259 0.28
260 0.26
261 0.23
262 0.21
263 0.21
264 0.18
265 0.16
266 0.12
267 0.1
268 0.13
269 0.12
270 0.13
271 0.12
272 0.12
273 0.12
274 0.13
275 0.13
276 0.07
277 0.08
278 0.07
279 0.08
280 0.08
281 0.08
282 0.07
283 0.08
284 0.08
285 0.09
286 0.08
287 0.07
288 0.07
289 0.07
290 0.07
291 0.06
292 0.06
293 0.05
294 0.05
295 0.05
296 0.06
297 0.05
298 0.06
299 0.09
300 0.09
301 0.1
302 0.14
303 0.15
304 0.16
305 0.21
306 0.24
307 0.26
308 0.31
309 0.31
310 0.27
311 0.27
312 0.3
313 0.29
314 0.25
315 0.26
316 0.26
317 0.24
318 0.26
319 0.29
320 0.29
321 0.34
322 0.44
323 0.48
324 0.53
325 0.61
326 0.7
327 0.77
328 0.81
329 0.83
330 0.84
331 0.83
332 0.86
333 0.85
334 0.81
335 0.72
336 0.67
337 0.58
338 0.54
339 0.52
340 0.45
341 0.46
342 0.47
343 0.52
344 0.51
345 0.52
346 0.53
347 0.55
348 0.57
349 0.5
350 0.45
351 0.42
352 0.44
353 0.42
354 0.34
355 0.25
356 0.2
357 0.21
358 0.2
359 0.19
360 0.17
361 0.18
362 0.23
363 0.25
364 0.27