Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A512UF24

Protein Details
Accession A0A512UF24   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
23-51YPQTKDPETKDPNKRPKQKTQKHSQKGFAHydrophilic
NLS Segment(s)
PositionSequence
34-67PNKRPKQKTQKHSQKGFAGLRKRTTPPKALIVRR
Subcellular Location(s) cyto_nucl 4.5, mito 18, nucl 6.5
Family & Domain DBs
Amino Acid Sequences MNYFRPRILQGLVAQSYAHPSKYPQTKDPETKDPNKRPKQKTQKHSQKGFAGLRKRTTPPKALIVRRHQSTVRPKALSKTRSFNGWAQWSRRQTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.23
3 0.27
4 0.24
5 0.21
6 0.14
7 0.15
8 0.23
9 0.32
10 0.37
11 0.37
12 0.44
13 0.52
14 0.59
15 0.63
16 0.65
17 0.64
18 0.69
19 0.73
20 0.74
21 0.77
22 0.79
23 0.83
24 0.8
25 0.84
26 0.86
27 0.85
28 0.85
29 0.85
30 0.86
31 0.85
32 0.84
33 0.78
34 0.7
35 0.67
36 0.63
37 0.58
38 0.54
39 0.48
40 0.46
41 0.44
42 0.45
43 0.45
44 0.45
45 0.44
46 0.41
47 0.46
48 0.51
49 0.54
50 0.59
51 0.61
52 0.64
53 0.6
54 0.61
55 0.53
56 0.53
57 0.57
58 0.58
59 0.56
60 0.52
61 0.51
62 0.56
63 0.64
64 0.63
65 0.58
66 0.56
67 0.51
68 0.52
69 0.55
70 0.5
71 0.49
72 0.51
73 0.52
74 0.5
75 0.57