FuNGI

A0A512UAC5

Protein Details

Accession

A0A512UAC5

Localization Confidence

Low

Confidence Score

9.5

NoLS Segment(s)

Position	Sequence	Protein Nature
427-450	AVQSPQSTGQTPRRKRRQRSVLDA	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 15.5, cyto_nucl 9.5, mito 7, cyto 2.5

Family & Domain DBs

InterPro	View protein in InterPro IPR004875 DDE_SF_endonuclease_dom IPR006600 HTH_CenpB_DNA-bd_dom IPR036397 RNaseH_sf
Gene Ontology	GO:0003676 F:nucleic acid binding
Pfam	View protein in Pfam PF03184 DDE_1
PROSITE	View protein in PROSITE PS51253 HTH_CENPB

Amino Acid Sequences

MAQHLLQARGVRPTPKLGQNWVRGFLKRHPGVFKGPGDLDRAQCETPEMYSDWFGRVQSTCSQHGILEDDIYSFDEVGFTMGPLTTTKAVTGVQLRNDPSMLGPQNSEWVTVIECASAAGFSVPPYIVIADKRLKKAWYKGKPTDWRLQVSDNGRTSQEIALFWLKEVFLPSTNGRTKGKHRLLLLDEQNDHLTPDFRDVCEANNIKVQCIPRHASSRLNPLDLVCFSVLKYSYNQLIHKQMRLGVADMGKLMFLDAYAQTREPAFNPDTIKSAFRATGLAPFDPELVKSSLPVIMTRKELIESQKAHSHHAMLKKMEDQVYSLLGNETKEIQDEMKPWFDKLVEFTHMAVDSSCFMAEKLKRVRQDEWLEEHEEEIAEDASFREKMPSFENVYEIFVRSPSNIQVVTDDDGEERRPRSGDQTSESAVQSPQSTGQTPRRKRRQRSVLDA

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.44
2	0.48
3	0.51
4	0.53
5	0.59
6	0.64
7	0.66
8	0.66
9	0.62
10	0.58
11	0.59
12	0.58
13	0.59
14	0.54
15	0.55
16	0.54
17	0.54
18	0.57
19	0.6
20	0.54
21	0.49
22	0.47
23	0.43
24	0.43
25	0.43
26	0.38
27	0.34
28	0.35
29	0.3
30	0.27
31	0.27
32	0.23
33	0.2
34	0.2
35	0.18
36	0.16
37	0.19
38	0.2
39	0.2
40	0.2
41	0.19
42	0.2
43	0.19
44	0.21
45	0.24
46	0.28
47	0.29
48	0.3
49	0.3
50	0.27
51	0.28
52	0.28
53	0.22
54	0.18
55	0.15
56	0.13
57	0.13
58	0.14
59	0.12
60	0.09
61	0.08
62	0.07
63	0.07
64	0.07
65	0.07
66	0.05
67	0.06
68	0.06
69	0.07
70	0.07
71	0.1
72	0.11
73	0.11
74	0.11
75	0.12
76	0.12
77	0.15
78	0.21
79	0.22
80	0.24
81	0.29
82	0.3
83	0.3
84	0.3
85	0.27
86	0.2
87	0.24
88	0.23
89	0.2
90	0.19
91	0.18
92	0.23
93	0.23
94	0.23
95	0.16
96	0.14
97	0.14
98	0.14
99	0.14
100	0.08
101	0.08
102	0.07
103	0.07
104	0.06
105	0.05
106	0.04
107	0.04
108	0.05
109	0.06
110	0.06
111	0.06
112	0.07
113	0.07
114	0.08
115	0.09
116	0.14
117	0.2
118	0.25
119	0.28
120	0.31
121	0.34
122	0.38
123	0.47
124	0.52
125	0.55
126	0.6
127	0.64
128	0.71
129	0.77
130	0.78
131	0.77
132	0.71
133	0.65
134	0.58
135	0.53
136	0.49
137	0.44
138	0.45
139	0.38
140	0.34
141	0.3
142	0.28
143	0.28
144	0.23
145	0.21
146	0.13
147	0.14
148	0.16
149	0.16
150	0.15
151	0.14
152	0.12
153	0.11
154	0.13
155	0.11
156	0.09
157	0.12
158	0.13
159	0.2
160	0.23
161	0.26
162	0.26
163	0.29
164	0.34
165	0.42
166	0.47
167	0.44
168	0.43
169	0.45
170	0.46
171	0.5
172	0.48
173	0.41
174	0.36
175	0.33
176	0.32
177	0.26
178	0.23
179	0.15
180	0.12
181	0.09
182	0.13
183	0.13
184	0.12
185	0.14
186	0.14
187	0.15
188	0.21
189	0.22
190	0.18
191	0.21
192	0.21
193	0.19
194	0.22
195	0.23
196	0.17
197	0.21
198	0.23
199	0.22
200	0.28
201	0.29
202	0.32
203	0.33
204	0.4
205	0.37
206	0.35
207	0.32
208	0.27
209	0.27
210	0.21
211	0.2
212	0.1
213	0.09
214	0.08
215	0.1
216	0.1
217	0.09
218	0.1
219	0.1
220	0.14
221	0.17
222	0.18
223	0.19
224	0.28
225	0.29
226	0.29
227	0.28
228	0.27
229	0.26
230	0.25
231	0.23
232	0.17
233	0.15
234	0.14
235	0.13
236	0.11
237	0.08
238	0.07
239	0.06
240	0.04
241	0.03
242	0.04
243	0.04
244	0.06
245	0.07
246	0.07
247	0.08
248	0.09
249	0.1
250	0.09
251	0.13
252	0.13
253	0.16
254	0.18
255	0.18
256	0.21
257	0.21
258	0.21
259	0.18
260	0.18
261	0.15
262	0.13
263	0.14
264	0.11
265	0.16
266	0.16
267	0.15
268	0.14
269	0.14
270	0.15
271	0.14
272	0.13
273	0.11
274	0.11
275	0.1
276	0.1
277	0.11
278	0.12
279	0.12
280	0.14
281	0.14
282	0.15
283	0.17
284	0.18
285	0.17
286	0.17
287	0.19
288	0.21
289	0.25
290	0.25
291	0.27
292	0.32
293	0.32
294	0.34
295	0.33
296	0.32
297	0.3
298	0.34
299	0.36
300	0.32
301	0.33
302	0.33
303	0.36
304	0.34
305	0.29
306	0.24
307	0.2
308	0.2
309	0.18
310	0.16
311	0.13
312	0.12
313	0.12
314	0.11
315	0.11
316	0.1
317	0.11
318	0.11
319	0.12
320	0.13
321	0.15
322	0.18
323	0.24
324	0.24
325	0.23
326	0.24
327	0.23
328	0.21
329	0.23
330	0.23
331	0.19
332	0.2
333	0.2
334	0.21
335	0.21
336	0.2
337	0.16
338	0.13
339	0.11
340	0.1
341	0.1
342	0.08
343	0.07
344	0.14
345	0.17
346	0.25
347	0.33
348	0.38
349	0.44
350	0.49
351	0.52
352	0.55
353	0.6
354	0.58
355	0.55
356	0.53
357	0.5
358	0.45
359	0.42
360	0.34
361	0.25
362	0.19
363	0.14
364	0.1
365	0.07
366	0.07
367	0.07
368	0.09
369	0.1
370	0.1
371	0.14
372	0.15
373	0.17
374	0.21
375	0.26
376	0.29
377	0.29
378	0.32
379	0.28
380	0.3
381	0.29
382	0.27
383	0.22
384	0.18
385	0.18
386	0.16
387	0.18
388	0.17
389	0.2
390	0.19
391	0.19
392	0.19
393	0.21
394	0.22
395	0.2
396	0.19
397	0.16
398	0.17
399	0.2
400	0.23
401	0.21
402	0.22
403	0.23
404	0.24
405	0.3
406	0.36
407	0.39
408	0.39
409	0.43
410	0.43
411	0.45
412	0.44
413	0.38
414	0.31
415	0.27
416	0.23
417	0.2
418	0.21
419	0.21
420	0.23
421	0.29
422	0.39
423	0.47
424	0.56
425	0.66
426	0.73
427	0.8
428	0.88
429	0.92
430	0.92

A0A512UAC5

3D AlphaFold-predicted Structure Viewer