Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A512UBI8

Protein Details
Accession A0A512UBI8    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
11-36PASKEKPTKASSKRRAKRISNTPDEEHydrophilic
NLS Segment(s)
PositionSequence
9-28HFPASKEKPTKASSKRRAKR
Subcellular Location(s) mito 15, nucl 8.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MARSRYPKHFPASKEKPTKASSKRRAKRISNTPDEENSLLIFLSDLQLNLITSIGHVTGLRPSPRLTTLGTPPQNPIYFRSGISHTGSTHILVHEQTNHSTKEKSTIPKQITKSDIPVWKVKGYLFSTSIETFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.71
3 0.7
4 0.67
5 0.71
6 0.7
7 0.72
8 0.72
9 0.73
10 0.78
11 0.82
12 0.87
13 0.86
14 0.86
15 0.85
16 0.85
17 0.83
18 0.8
19 0.74
20 0.66
21 0.61
22 0.51
23 0.41
24 0.3
25 0.21
26 0.15
27 0.11
28 0.08
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.06
36 0.06
37 0.06
38 0.04
39 0.04
40 0.05
41 0.04
42 0.04
43 0.04
44 0.05
45 0.07
46 0.11
47 0.12
48 0.12
49 0.13
50 0.14
51 0.15
52 0.17
53 0.15
54 0.15
55 0.18
56 0.26
57 0.27
58 0.26
59 0.26
60 0.29
61 0.29
62 0.27
63 0.26
64 0.22
65 0.21
66 0.21
67 0.22
68 0.2
69 0.21
70 0.23
71 0.21
72 0.17
73 0.19
74 0.18
75 0.17
76 0.16
77 0.13
78 0.12
79 0.11
80 0.12
81 0.14
82 0.15
83 0.18
84 0.2
85 0.22
86 0.23
87 0.24
88 0.23
89 0.25
90 0.29
91 0.34
92 0.38
93 0.45
94 0.48
95 0.55
96 0.58
97 0.59
98 0.59
99 0.54
100 0.52
101 0.51
102 0.51
103 0.47
104 0.5
105 0.47
106 0.43
107 0.42
108 0.37
109 0.38
110 0.35
111 0.36
112 0.31
113 0.29
114 0.32