Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507R6T1

Protein Details
Accession A0A507R6T1   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-38RNSPSTFQKLKSRIKRILRRKRKSAERRSENRGPGPHydrophilic
NLS Segment(s)
PositionSequence
11-37KLKSRIKRILRRKRKSAERRSENRGPG
Subcellular Location(s) cyto_nucl 10.333, mito 8.5, mito_nucl 12.166, nucl 14.5
Family & Domain DBs
Amino Acid Sequences MPRNSPSTFQKLKSRIKRILRRKRKSAERRSENRGPGPEVRTETRPARPSVAFDAPNVGASRSIHPRPATSTGVRMTNRKEGPNTRIKNNASAMERRAGRVPSPVHAASPGVARPAKNVPQTPGSSSRRQWTIPIGYAME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.76
3 0.8
4 0.86
5 0.87
6 0.89
7 0.9
8 0.89
9 0.9
10 0.91
11 0.92
12 0.92
13 0.92
14 0.92
15 0.91
16 0.89
17 0.87
18 0.85
19 0.8
20 0.76
21 0.68
22 0.61
23 0.56
24 0.51
25 0.47
26 0.42
27 0.39
28 0.36
29 0.37
30 0.36
31 0.38
32 0.39
33 0.36
34 0.36
35 0.34
36 0.34
37 0.34
38 0.35
39 0.29
40 0.25
41 0.27
42 0.22
43 0.23
44 0.21
45 0.15
46 0.11
47 0.12
48 0.15
49 0.17
50 0.18
51 0.2
52 0.2
53 0.21
54 0.23
55 0.27
56 0.27
57 0.22
58 0.24
59 0.22
60 0.28
61 0.28
62 0.27
63 0.25
64 0.3
65 0.32
66 0.31
67 0.34
68 0.33
69 0.39
70 0.46
71 0.46
72 0.42
73 0.47
74 0.46
75 0.47
76 0.44
77 0.43
78 0.37
79 0.36
80 0.35
81 0.33
82 0.32
83 0.29
84 0.3
85 0.26
86 0.24
87 0.27
88 0.26
89 0.23
90 0.29
91 0.27
92 0.24
93 0.24
94 0.23
95 0.18
96 0.19
97 0.16
98 0.15
99 0.17
100 0.16
101 0.19
102 0.26
103 0.31
104 0.36
105 0.38
106 0.38
107 0.42
108 0.45
109 0.47
110 0.5
111 0.49
112 0.49
113 0.5
114 0.53
115 0.51
116 0.5
117 0.48
118 0.47
119 0.48
120 0.45