Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2L6Z1

Protein Details
Accession E2L6Z1   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-24TYPNRRKKNKPRNWKLRSIGKEAGHydrophilic
NLS Segment(s)
PositionSequence
5-19RRKKNKPRNWKLRSI
Subcellular Location(s) nucl 20, mito 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039768  Nmd3  
Gene Ontology GO:0043023  F:ribosomal large subunit binding  
KEGG mpr:MPER_01619  -  
Amino Acid Sequences TYPNRRKKNKPRNWKLRSIGKEAGEEGETGSGRGVVGRIGGRDQKKVEEDYELFLRDLEEDPEMRGAVNLYKAAADVKIKSEGARKNQYAMDVDDHQAAGGEDEEDEADFPEVQLDEVVGRVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.89
3 0.88
4 0.84
5 0.8
6 0.75
7 0.66
8 0.6
9 0.51
10 0.44
11 0.34
12 0.28
13 0.2
14 0.16
15 0.13
16 0.11
17 0.1
18 0.08
19 0.07
20 0.07
21 0.07
22 0.04
23 0.06
24 0.07
25 0.08
26 0.1
27 0.17
28 0.19
29 0.22
30 0.23
31 0.25
32 0.26
33 0.28
34 0.26
35 0.24
36 0.23
37 0.22
38 0.23
39 0.2
40 0.18
41 0.16
42 0.15
43 0.11
44 0.11
45 0.09
46 0.08
47 0.07
48 0.07
49 0.08
50 0.08
51 0.07
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.07
61 0.08
62 0.08
63 0.08
64 0.1
65 0.12
66 0.13
67 0.14
68 0.2
69 0.25
70 0.32
71 0.39
72 0.38
73 0.38
74 0.39
75 0.4
76 0.36
77 0.32
78 0.29
79 0.23
80 0.24
81 0.21
82 0.2
83 0.17
84 0.15
85 0.13
86 0.09
87 0.07
88 0.06
89 0.05
90 0.06
91 0.06
92 0.06
93 0.06
94 0.06
95 0.07
96 0.07
97 0.07
98 0.08
99 0.08
100 0.09
101 0.08
102 0.08
103 0.07