Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507QXT6

Protein Details
Accession A0A507QXT6   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
24-47EPAATDKPESRKRKRDSHDGDPAEBasic
NLS Segment(s)
Subcellular Location(s) cyto 5.5, cyto_nucl 13, nucl 19.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021661  Rap1_C  
IPR038104  Rap1_C_sf  
IPR039595  TE2IP/Rap1  
Gene Ontology GO:0000781  C:chromosome, telomeric region  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
GO:0010833  P:telomere maintenance via telomere lengthening  
Pfam View protein in Pfam  
PF11626  Rap1_C  
CDD cd11653  rap1_RCT  
Amino Acid Sequences MLEASPGPSAPSRIAEDMARQGAEPAATDKPESRKRKRDSHDGDPAELLTSQQIHTSPKRRVTRASSRRELLSSSSLQPRLEIPETRRQVSETANQATELEDTQQEPQDTQKDKGKTSELDDTFNILTELPFFPLSPEPEDEDEGEEESESEKNIDAWVDKRLETGKAKNVVQVIEALRCTSMDPHLADQVLEHLVAGKGIPQNTPGIWTPEDDKAMEGIEARSIERVLDKHGRDSFNARWEYLSLARAAGLETNTGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.26
4 0.29
5 0.3
6 0.26
7 0.22
8 0.21
9 0.21
10 0.19
11 0.16
12 0.14
13 0.14
14 0.15
15 0.16
16 0.2
17 0.29
18 0.38
19 0.48
20 0.55
21 0.62
22 0.69
23 0.78
24 0.81
25 0.83
26 0.81
27 0.81
28 0.81
29 0.74
30 0.68
31 0.58
32 0.51
33 0.4
34 0.32
35 0.22
36 0.13
37 0.11
38 0.1
39 0.11
40 0.12
41 0.16
42 0.24
43 0.31
44 0.36
45 0.45
46 0.52
47 0.54
48 0.59
49 0.63
50 0.67
51 0.69
52 0.72
53 0.7
54 0.65
55 0.64
56 0.58
57 0.5
58 0.42
59 0.37
60 0.3
61 0.27
62 0.3
63 0.3
64 0.29
65 0.28
66 0.26
67 0.27
68 0.27
69 0.27
70 0.26
71 0.34
72 0.37
73 0.38
74 0.37
75 0.33
76 0.32
77 0.31
78 0.33
79 0.29
80 0.28
81 0.26
82 0.26
83 0.25
84 0.23
85 0.2
86 0.14
87 0.1
88 0.08
89 0.08
90 0.1
91 0.12
92 0.11
93 0.11
94 0.13
95 0.19
96 0.21
97 0.23
98 0.28
99 0.29
100 0.29
101 0.32
102 0.33
103 0.27
104 0.28
105 0.34
106 0.28
107 0.28
108 0.27
109 0.26
110 0.23
111 0.21
112 0.18
113 0.09
114 0.08
115 0.07
116 0.08
117 0.07
118 0.07
119 0.07
120 0.08
121 0.1
122 0.12
123 0.12
124 0.13
125 0.14
126 0.15
127 0.16
128 0.15
129 0.14
130 0.13
131 0.11
132 0.1
133 0.08
134 0.07
135 0.07
136 0.07
137 0.05
138 0.06
139 0.05
140 0.05
141 0.06
142 0.06
143 0.06
144 0.07
145 0.11
146 0.12
147 0.12
148 0.14
149 0.15
150 0.19
151 0.22
152 0.25
153 0.28
154 0.32
155 0.32
156 0.33
157 0.34
158 0.29
159 0.26
160 0.25
161 0.2
162 0.16
163 0.16
164 0.14
165 0.12
166 0.12
167 0.12
168 0.1
169 0.1
170 0.12
171 0.13
172 0.15
173 0.17
174 0.17
175 0.16
176 0.14
177 0.15
178 0.12
179 0.1
180 0.08
181 0.07
182 0.07
183 0.07
184 0.07
185 0.09
186 0.11
187 0.12
188 0.13
189 0.13
190 0.15
191 0.15
192 0.19
193 0.16
194 0.18
195 0.18
196 0.19
197 0.21
198 0.23
199 0.25
200 0.22
201 0.21
202 0.17
203 0.17
204 0.16
205 0.14
206 0.1
207 0.11
208 0.12
209 0.11
210 0.12
211 0.12
212 0.12
213 0.14
214 0.15
215 0.19
216 0.27
217 0.28
218 0.34
219 0.41
220 0.42
221 0.42
222 0.47
223 0.46
224 0.47
225 0.48
226 0.41
227 0.36
228 0.34
229 0.36
230 0.33
231 0.29
232 0.21
233 0.18
234 0.18
235 0.17
236 0.17
237 0.15
238 0.12