Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507AL10

Protein Details
Accession A0A507AL10    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
8-27PPCCCRSDSRARRHSPPIRAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 4.5, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000592  Ribosomal_S27  
IPR023407  Ribosomal_S27_Zn-bd_dom_sf  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01667  Ribosomal_S27e  
Amino Acid Sequences MVSRLPAPPCCCRSDSRARRHSPPIRANATDEPIKRRINLRRRVVGRVNGMIFGNDSDVLATIAGREIRWHSRVLAVDLLNPSPAAEAKKHKLKMLVPAPRSFFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLTEGCSFRRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.59
3 0.61
4 0.67
5 0.69
6 0.73
7 0.8
8 0.8
9 0.79
10 0.78
11 0.76
12 0.72
13 0.68
14 0.66
15 0.6
16 0.55
17 0.51
18 0.45
19 0.42
20 0.42
21 0.42
22 0.39
23 0.42
24 0.48
25 0.52
26 0.59
27 0.62
28 0.65
29 0.67
30 0.72
31 0.7
32 0.66
33 0.61
34 0.55
35 0.47
36 0.39
37 0.35
38 0.28
39 0.22
40 0.16
41 0.12
42 0.07
43 0.07
44 0.05
45 0.05
46 0.05
47 0.05
48 0.04
49 0.03
50 0.05
51 0.05
52 0.05
53 0.06
54 0.09
55 0.12
56 0.14
57 0.15
58 0.14
59 0.17
60 0.18
61 0.19
62 0.19
63 0.15
64 0.16
65 0.16
66 0.15
67 0.12
68 0.11
69 0.09
70 0.06
71 0.08
72 0.07
73 0.1
74 0.15
75 0.21
76 0.29
77 0.3
78 0.32
79 0.35
80 0.36
81 0.42
82 0.46
83 0.48
84 0.44
85 0.46
86 0.47
87 0.44
88 0.44
89 0.36
90 0.29
91 0.23
92 0.26
93 0.26
94 0.25
95 0.24
96 0.23
97 0.21
98 0.21
99 0.19
100 0.15
101 0.18
102 0.18
103 0.19
104 0.21
105 0.22
106 0.21
107 0.22
108 0.2
109 0.15
110 0.13
111 0.13
112 0.15
113 0.15
114 0.14
115 0.13
116 0.13
117 0.13
118 0.13
119 0.14
120 0.14
121 0.15
122 0.16
123 0.17
124 0.17
125 0.24
126 0.3
127 0.3
128 0.26
129 0.25
130 0.3
131 0.35
132 0.38
133 0.38
134 0.37