Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507B148

Protein Details
Accession A0A507B148   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
337-368RVLVRGQPFFRRRHHCRRRGTSHSHHRKSSRTBasic
NLS Segment(s)
PositionSequence
247-265GHHKGHHHHKGHHHKGHHK
Subcellular Location(s) cyto 6, cyto_pero 3, extr 4, mito 3, nucl 4, plas 6
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLLKSLTLTTAGLAAAHALLVPPELSEPLPQLDDIVNVLPVEVPKIAQSQTFNLNCPGCPLFHHRGHHGSFRNKHTIPNHLELSFNVDHDTGSDRLTVNGFELYPNADPFSGTLTAPQIPDVEWHHRNRKPKAPSSPLTPQLGFSLQVNQEARDESDKMELINLNLQIIEVGETFVDGIQNVQIKLIQSLDGALMIGEIHATDSQTAHDSPKDKQKECSSILCKWRAMIADRLKGHCHGKFGMGRIGHHKGHHHHKGHHHKGHHKGHPMISDEEFAGRPEKTMDDEVAQMYRDRSFGQLLHKFASHIIFPVLIGIVAGVSVSILGMLVGTFIVGTWRVLVRGQPFFRRRHHCRRRGTSHSHHRKSSRTETASAEEKSGLMEEQEVEVEAPPAYDEEQAPKDAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.06
4 0.06
5 0.05
6 0.05
7 0.06
8 0.06
9 0.05
10 0.06
11 0.08
12 0.09
13 0.11
14 0.13
15 0.14
16 0.15
17 0.15
18 0.15
19 0.15
20 0.14
21 0.14
22 0.13
23 0.12
24 0.1
25 0.11
26 0.1
27 0.1
28 0.11
29 0.1
30 0.09
31 0.1
32 0.14
33 0.14
34 0.16
35 0.19
36 0.21
37 0.3
38 0.31
39 0.31
40 0.34
41 0.35
42 0.31
43 0.33
44 0.31
45 0.22
46 0.24
47 0.3
48 0.32
49 0.38
50 0.42
51 0.42
52 0.48
53 0.52
54 0.56
55 0.56
56 0.58
57 0.6
58 0.63
59 0.67
60 0.6
61 0.64
62 0.59
63 0.61
64 0.57
65 0.56
66 0.52
67 0.44
68 0.43
69 0.36
70 0.4
71 0.31
72 0.25
73 0.2
74 0.16
75 0.15
76 0.15
77 0.19
78 0.12
79 0.12
80 0.14
81 0.12
82 0.13
83 0.14
84 0.14
85 0.11
86 0.12
87 0.11
88 0.09
89 0.1
90 0.11
91 0.12
92 0.12
93 0.12
94 0.1
95 0.1
96 0.1
97 0.13
98 0.12
99 0.11
100 0.12
101 0.13
102 0.15
103 0.15
104 0.15
105 0.12
106 0.11
107 0.14
108 0.17
109 0.22
110 0.27
111 0.33
112 0.42
113 0.46
114 0.54
115 0.59
116 0.64
117 0.65
118 0.68
119 0.71
120 0.71
121 0.7
122 0.69
123 0.69
124 0.65
125 0.6
126 0.51
127 0.42
128 0.35
129 0.33
130 0.25
131 0.18
132 0.19
133 0.15
134 0.2
135 0.2
136 0.19
137 0.18
138 0.19
139 0.2
140 0.16
141 0.16
142 0.12
143 0.14
144 0.14
145 0.13
146 0.14
147 0.13
148 0.11
149 0.14
150 0.13
151 0.1
152 0.1
153 0.1
154 0.08
155 0.07
156 0.07
157 0.04
158 0.04
159 0.04
160 0.04
161 0.04
162 0.04
163 0.04
164 0.03
165 0.03
166 0.05
167 0.07
168 0.07
169 0.07
170 0.08
171 0.08
172 0.09
173 0.09
174 0.08
175 0.06
176 0.07
177 0.06
178 0.05
179 0.05
180 0.04
181 0.03
182 0.03
183 0.03
184 0.02
185 0.02
186 0.03
187 0.03
188 0.03
189 0.04
190 0.04
191 0.05
192 0.06
193 0.07
194 0.08
195 0.1
196 0.12
197 0.15
198 0.24
199 0.31
200 0.3
201 0.35
202 0.4
203 0.44
204 0.45
205 0.51
206 0.46
207 0.45
208 0.5
209 0.49
210 0.43
211 0.37
212 0.36
213 0.3
214 0.28
215 0.3
216 0.29
217 0.32
218 0.34
219 0.36
220 0.35
221 0.36
222 0.38
223 0.31
224 0.28
225 0.22
226 0.25
227 0.26
228 0.26
229 0.28
230 0.25
231 0.25
232 0.28
233 0.32
234 0.29
235 0.28
236 0.31
237 0.33
238 0.42
239 0.5
240 0.49
241 0.5
242 0.59
243 0.68
244 0.74
245 0.74
246 0.71
247 0.7
248 0.75
249 0.79
250 0.75
251 0.71
252 0.65
253 0.63
254 0.6
255 0.55
256 0.48
257 0.39
258 0.33
259 0.26
260 0.23
261 0.2
262 0.16
263 0.15
264 0.11
265 0.11
266 0.11
267 0.12
268 0.13
269 0.14
270 0.15
271 0.14
272 0.15
273 0.16
274 0.15
275 0.15
276 0.13
277 0.13
278 0.13
279 0.12
280 0.12
281 0.12
282 0.14
283 0.16
284 0.24
285 0.28
286 0.29
287 0.3
288 0.3
289 0.28
290 0.28
291 0.27
292 0.18
293 0.14
294 0.13
295 0.11
296 0.1
297 0.11
298 0.09
299 0.06
300 0.06
301 0.05
302 0.04
303 0.03
304 0.03
305 0.02
306 0.02
307 0.02
308 0.02
309 0.02
310 0.02
311 0.02
312 0.02
313 0.02
314 0.02
315 0.02
316 0.02
317 0.02
318 0.02
319 0.04
320 0.04
321 0.05
322 0.07
323 0.08
324 0.09
325 0.1
326 0.14
327 0.19
328 0.27
329 0.31
330 0.39
331 0.45
332 0.52
333 0.6
334 0.67
335 0.71
336 0.74
337 0.81
338 0.8
339 0.85
340 0.89
341 0.89
342 0.89
343 0.89
344 0.89
345 0.89
346 0.91
347 0.88
348 0.85
349 0.81
350 0.8
351 0.79
352 0.78
353 0.77
354 0.7
355 0.66
356 0.62
357 0.62
358 0.61
359 0.53
360 0.44
361 0.34
362 0.29
363 0.26
364 0.23
365 0.17
366 0.11
367 0.11
368 0.1
369 0.11
370 0.11
371 0.11
372 0.11
373 0.11
374 0.11
375 0.1
376 0.09
377 0.08
378 0.09
379 0.1
380 0.12
381 0.13
382 0.18
383 0.21