Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A507B7Z7

Protein Details
Accession A0A507B7Z7    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
308-328DQPPPKPKKGLTRAPRPRLSPBasic
406-428AAGTPRKKKPVDIFMRPKKKVVRBasic
NLS Segment(s)
PositionSequence
223-249APKPKKPRTERDEKESRLLAIKNKTAR
312-336PKPKKGLTRAPRPRLSPDRSPAAKK
396-428RSPPPGLRAAAAGTPRKKKPVDIFMRPKKKVVR
Subcellular Location(s) mito 20, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR010684  RNA_pol_II_trans_fac_SIII_A  
Gene Ontology GO:0070449  C:elongin complex  
GO:0006368  P:transcription elongation by RNA polymerase II  
Pfam View protein in Pfam  
PF06881  Elongin_A  
Amino Acid Sequences MDSSTTKRIGPASLQAMCLKAAMRNVRHVWDFGNLPIELIRPILAKVSNAEQLHHLEMSSPEIADETAAIWHELLKKKFMFLYQQEEPTPGLNYYEVYRSLDTIHKKRDAEATAELKARFSAHEKEKDDKTVSIVSQANLPRLPGRRRRGFGFGTTGSSAPAKTGGGRIMQQVRQEVRNYQKTTKLVTATGSLPVKAGQIKEAPKAMINDQRIAQNPAIKIQAPKPKKPRTERDEKESRLLAIKNKTARKSSEPAEKPYDGLEDLFGEPEELARSKKRSRDDLDDLAERIVSYGAKRARVELTPEDLDQPPPKPKKGLTRAPRPRLSPDRSPAAKKSTGLLSNKHGATPQPALRRSSAATGSGSTTSTTAAPPKQSADTSTARKPAAASPSGSPTRSPPPGLRAAAAGTPRKKKPVDIFMRPKKKVVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.35
4 0.31
5 0.29
6 0.22
7 0.17
8 0.22
9 0.28
10 0.3
11 0.37
12 0.41
13 0.45
14 0.46
15 0.44
16 0.39
17 0.35
18 0.34
19 0.27
20 0.28
21 0.22
22 0.21
23 0.2
24 0.19
25 0.15
26 0.14
27 0.14
28 0.1
29 0.1
30 0.13
31 0.14
32 0.14
33 0.16
34 0.19
35 0.25
36 0.25
37 0.26
38 0.25
39 0.27
40 0.29
41 0.26
42 0.22
43 0.17
44 0.17
45 0.2
46 0.18
47 0.14
48 0.11
49 0.12
50 0.12
51 0.1
52 0.09
53 0.06
54 0.06
55 0.07
56 0.07
57 0.07
58 0.1
59 0.17
60 0.23
61 0.25
62 0.29
63 0.29
64 0.31
65 0.34
66 0.34
67 0.36
68 0.34
69 0.4
70 0.39
71 0.43
72 0.41
73 0.41
74 0.38
75 0.31
76 0.28
77 0.2
78 0.16
79 0.12
80 0.13
81 0.13
82 0.15
83 0.15
84 0.16
85 0.16
86 0.15
87 0.18
88 0.23
89 0.29
90 0.34
91 0.4
92 0.43
93 0.43
94 0.45
95 0.5
96 0.46
97 0.42
98 0.42
99 0.38
100 0.36
101 0.39
102 0.36
103 0.29
104 0.28
105 0.24
106 0.19
107 0.2
108 0.25
109 0.28
110 0.37
111 0.4
112 0.46
113 0.48
114 0.51
115 0.49
116 0.41
117 0.37
118 0.32
119 0.28
120 0.29
121 0.28
122 0.22
123 0.26
124 0.27
125 0.26
126 0.22
127 0.23
128 0.22
129 0.27
130 0.35
131 0.39
132 0.46
133 0.52
134 0.55
135 0.58
136 0.6
137 0.56
138 0.51
139 0.48
140 0.4
141 0.34
142 0.32
143 0.28
144 0.22
145 0.2
146 0.17
147 0.11
148 0.1
149 0.08
150 0.07
151 0.09
152 0.1
153 0.11
154 0.12
155 0.16
156 0.2
157 0.22
158 0.23
159 0.26
160 0.27
161 0.29
162 0.29
163 0.3
164 0.34
165 0.4
166 0.42
167 0.4
168 0.44
169 0.42
170 0.44
171 0.42
172 0.35
173 0.28
174 0.25
175 0.24
176 0.19
177 0.22
178 0.19
179 0.15
180 0.14
181 0.13
182 0.14
183 0.13
184 0.12
185 0.1
186 0.14
187 0.16
188 0.18
189 0.19
190 0.18
191 0.18
192 0.19
193 0.21
194 0.22
195 0.22
196 0.21
197 0.21
198 0.24
199 0.23
200 0.25
201 0.22
202 0.2
203 0.19
204 0.19
205 0.19
206 0.17
207 0.18
208 0.21
209 0.29
210 0.31
211 0.38
212 0.47
213 0.54
214 0.62
215 0.69
216 0.73
217 0.71
218 0.78
219 0.75
220 0.73
221 0.74
222 0.67
223 0.63
224 0.53
225 0.46
226 0.39
227 0.37
228 0.34
229 0.29
230 0.32
231 0.34
232 0.39
233 0.41
234 0.41
235 0.42
236 0.42
237 0.42
238 0.43
239 0.47
240 0.45
241 0.47
242 0.49
243 0.46
244 0.4
245 0.36
246 0.32
247 0.22
248 0.19
249 0.14
250 0.1
251 0.1
252 0.09
253 0.08
254 0.07
255 0.07
256 0.07
257 0.08
258 0.07
259 0.09
260 0.12
261 0.18
262 0.23
263 0.29
264 0.34
265 0.41
266 0.46
267 0.53
268 0.56
269 0.57
270 0.57
271 0.53
272 0.48
273 0.39
274 0.33
275 0.24
276 0.18
277 0.12
278 0.08
279 0.07
280 0.13
281 0.15
282 0.19
283 0.2
284 0.22
285 0.25
286 0.26
287 0.31
288 0.27
289 0.3
290 0.28
291 0.28
292 0.29
293 0.27
294 0.28
295 0.26
296 0.26
297 0.3
298 0.33
299 0.35
300 0.36
301 0.4
302 0.48
303 0.55
304 0.62
305 0.62
306 0.68
307 0.77
308 0.82
309 0.83
310 0.75
311 0.75
312 0.74
313 0.72
314 0.69
315 0.64
316 0.65
317 0.64
318 0.66
319 0.61
320 0.58
321 0.55
322 0.47
323 0.44
324 0.42
325 0.44
326 0.42
327 0.41
328 0.39
329 0.43
330 0.43
331 0.4
332 0.34
333 0.29
334 0.31
335 0.34
336 0.35
337 0.36
338 0.39
339 0.42
340 0.42
341 0.44
342 0.4
343 0.38
344 0.34
345 0.27
346 0.25
347 0.23
348 0.24
349 0.22
350 0.2
351 0.16
352 0.14
353 0.13
354 0.12
355 0.13
356 0.16
357 0.19
358 0.22
359 0.23
360 0.26
361 0.28
362 0.29
363 0.3
364 0.3
365 0.34
366 0.37
367 0.41
368 0.44
369 0.4
370 0.4
371 0.39
372 0.39
373 0.39
374 0.37
375 0.33
376 0.31
377 0.39
378 0.42
379 0.41
380 0.36
381 0.33
382 0.39
383 0.41
384 0.42
385 0.38
386 0.41
387 0.48
388 0.49
389 0.45
390 0.38
391 0.36
392 0.36
393 0.37
394 0.39
395 0.39
396 0.46
397 0.49
398 0.56
399 0.56
400 0.6
401 0.64
402 0.66
403 0.68
404 0.71
405 0.78
406 0.81
407 0.89
408 0.83