Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507AK61

Protein Details
Accession A0A507AK61   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAKSSRASTRKANNQRLKKNVFGHydrophilic
86-123KASTGSKPGKKRIEKRRVKKSSIVFPKYKDRRGQKKSKBasic
NLS Segment(s)
PositionSequence
85-123GKASTGSKPGKKRIEKRRVKKSSIVFPKYKDRRGQKKSK
Subcellular Location(s) cyto_nucl 11.5, mito 5, nucl 21.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSSRASTRKANNQRLKKNVFGPIESERAQRLSAKLLELASQPKPVKEAEMVDIAEVDDSAETAQKAQKDNEDEDMEIDSASKGKASTGSKPGKKRIEKRRVKKSSIVFPKYKDRRGQKKSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.87
3 0.88
4 0.84
5 0.79
6 0.74
7 0.71
8 0.64
9 0.55
10 0.5
11 0.45
12 0.44
13 0.39
14 0.35
15 0.27
16 0.26
17 0.25
18 0.23
19 0.2
20 0.2
21 0.2
22 0.19
23 0.19
24 0.18
25 0.19
26 0.18
27 0.21
28 0.17
29 0.22
30 0.22
31 0.2
32 0.21
33 0.2
34 0.2
35 0.18
36 0.18
37 0.14
38 0.16
39 0.16
40 0.14
41 0.14
42 0.12
43 0.1
44 0.08
45 0.06
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.04
52 0.06
53 0.08
54 0.11
55 0.12
56 0.16
57 0.18
58 0.2
59 0.24
60 0.23
61 0.21
62 0.2
63 0.2
64 0.16
65 0.13
66 0.11
67 0.07
68 0.06
69 0.06
70 0.06
71 0.05
72 0.05
73 0.11
74 0.14
75 0.2
76 0.29
77 0.38
78 0.45
79 0.51
80 0.6
81 0.64
82 0.71
83 0.76
84 0.78
85 0.79
86 0.84
87 0.87
88 0.9
89 0.89
90 0.86
91 0.84
92 0.81
93 0.81
94 0.81
95 0.78
96 0.72
97 0.68
98 0.73
99 0.74
100 0.73
101 0.72
102 0.72
103 0.75