Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507ARG7

Protein Details
Accession A0A507ARG7   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
60-80YLPPAPKKKERALRKFDRYSVHydrophilic
NLS Segment(s)
PositionSequence
66-70KKKER
Subcellular Location(s) cyto 6.5, cyto_nucl 11.5, mito 3, nucl 15.5
Family & Domain DBs
Amino Acid Sequences MSLERYQARGICVSSDSTPSPPTNPDDGVQFKHKGFKDVTVIKSRSVFGADEEMGPTSEYLPPAPKKKERALRKFDRYSVIVRRIFTRHGDRDMLVGTELCIQAPSLCKYFRGLVGDTHESFDISSTPIVMPAPFYELFYWRKDLAAYAENETHQENHADVKLLYDFFRTDRLTIDNMATYDSMIVQGKINVETLWTLYPPNKRLFLNTGEASECWLCRDVQRDPKNPLVWWVTGVQLGVNVRELGLTRRKHPISFARKIDGSMDISELPLVPEDYFDRAEQVKEEIGKRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.23
4 0.23
5 0.26
6 0.26
7 0.27
8 0.27
9 0.31
10 0.31
11 0.31
12 0.3
13 0.32
14 0.34
15 0.37
16 0.39
17 0.38
18 0.35
19 0.41
20 0.41
21 0.4
22 0.38
23 0.39
24 0.42
25 0.46
26 0.5
27 0.51
28 0.52
29 0.48
30 0.49
31 0.44
32 0.36
33 0.31
34 0.25
35 0.17
36 0.21
37 0.19
38 0.17
39 0.18
40 0.17
41 0.15
42 0.15
43 0.13
44 0.09
45 0.11
46 0.11
47 0.11
48 0.17
49 0.23
50 0.31
51 0.38
52 0.44
53 0.49
54 0.57
55 0.66
56 0.7
57 0.75
58 0.77
59 0.8
60 0.83
61 0.82
62 0.77
63 0.72
64 0.64
65 0.6
66 0.58
67 0.56
68 0.49
69 0.44
70 0.44
71 0.41
72 0.41
73 0.4
74 0.41
75 0.37
76 0.38
77 0.39
78 0.35
79 0.34
80 0.32
81 0.26
82 0.18
83 0.13
84 0.1
85 0.11
86 0.11
87 0.09
88 0.08
89 0.08
90 0.09
91 0.12
92 0.14
93 0.13
94 0.13
95 0.14
96 0.16
97 0.18
98 0.19
99 0.19
100 0.18
101 0.18
102 0.22
103 0.26
104 0.24
105 0.23
106 0.21
107 0.17
108 0.16
109 0.14
110 0.1
111 0.07
112 0.06
113 0.06
114 0.06
115 0.06
116 0.06
117 0.06
118 0.06
119 0.05
120 0.09
121 0.09
122 0.09
123 0.1
124 0.13
125 0.15
126 0.16
127 0.18
128 0.15
129 0.15
130 0.14
131 0.14
132 0.14
133 0.15
134 0.15
135 0.14
136 0.15
137 0.15
138 0.15
139 0.15
140 0.13
141 0.1
142 0.1
143 0.08
144 0.09
145 0.09
146 0.09
147 0.09
148 0.09
149 0.1
150 0.1
151 0.1
152 0.09
153 0.09
154 0.09
155 0.13
156 0.13
157 0.12
158 0.13
159 0.15
160 0.15
161 0.16
162 0.16
163 0.13
164 0.12
165 0.13
166 0.11
167 0.09
168 0.08
169 0.07
170 0.07
171 0.07
172 0.07
173 0.07
174 0.08
175 0.09
176 0.1
177 0.1
178 0.08
179 0.08
180 0.08
181 0.09
182 0.08
183 0.08
184 0.08
185 0.13
186 0.18
187 0.22
188 0.25
189 0.28
190 0.27
191 0.31
192 0.33
193 0.33
194 0.34
195 0.31
196 0.29
197 0.27
198 0.26
199 0.25
200 0.22
201 0.18
202 0.13
203 0.14
204 0.12
205 0.14
206 0.19
207 0.24
208 0.33
209 0.42
210 0.47
211 0.51
212 0.59
213 0.59
214 0.54
215 0.53
216 0.46
217 0.38
218 0.33
219 0.29
220 0.22
221 0.2
222 0.2
223 0.14
224 0.12
225 0.12
226 0.11
227 0.11
228 0.1
229 0.09
230 0.1
231 0.11
232 0.14
233 0.22
234 0.24
235 0.26
236 0.36
237 0.39
238 0.39
239 0.46
240 0.51
241 0.53
242 0.59
243 0.61
244 0.57
245 0.56
246 0.56
247 0.51
248 0.44
249 0.37
250 0.29
251 0.26
252 0.19
253 0.18
254 0.18
255 0.16
256 0.12
257 0.11
258 0.11
259 0.08
260 0.1
261 0.12
262 0.15
263 0.17
264 0.16
265 0.19
266 0.19
267 0.21
268 0.2
269 0.21
270 0.22
271 0.26