Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507ALI1

Protein Details
Accession A0A507ALI1   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
258-280TYTPRMQAAPKGKRRKVEKEAEAHydrophilic
NLS Segment(s)
PositionSequence
267-275PKGKRRKVE
Subcellular Location(s) cyto 6.5, cyto_nucl 9.5, mito 9, nucl 11.5
Family & Domain DBs
Amino Acid Sequences MPSHKPTLALTTPVTGTFPPDALRSAMSSRTPLSASWRELPSAGLPSAGIVSPHPGFVAVKTEEKTPITPPLAYMDFLKAMSVGSPAFPSPSMASPPLTGKHPLNRTSTAGSTSSNKTDTSASSEDSNEEERDEREIESGPSTATSVSTDVSCNCDPIPKSAKAAVPASPFANYPLSAPLTGPAAFPSMKIPPSPITNTDSPVRSPFSARSVKSPFDWEAALKARRYADAKSNHSCGKSSSSRTSVRHIREVVTRTVTYTPRMQAAPKGKRRKVEKEAEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.19
3 0.2
4 0.17
5 0.17
6 0.16
7 0.16
8 0.17
9 0.17
10 0.18
11 0.17
12 0.18
13 0.21
14 0.21
15 0.23
16 0.22
17 0.23
18 0.23
19 0.21
20 0.27
21 0.29
22 0.32
23 0.36
24 0.36
25 0.35
26 0.34
27 0.35
28 0.29
29 0.26
30 0.22
31 0.15
32 0.14
33 0.13
34 0.14
35 0.12
36 0.1
37 0.07
38 0.11
39 0.11
40 0.11
41 0.11
42 0.11
43 0.11
44 0.11
45 0.17
46 0.15
47 0.18
48 0.2
49 0.21
50 0.24
51 0.25
52 0.26
53 0.22
54 0.27
55 0.25
56 0.24
57 0.23
58 0.25
59 0.24
60 0.23
61 0.22
62 0.17
63 0.16
64 0.15
65 0.15
66 0.1
67 0.09
68 0.08
69 0.08
70 0.06
71 0.06
72 0.07
73 0.07
74 0.08
75 0.08
76 0.09
77 0.1
78 0.11
79 0.13
80 0.14
81 0.14
82 0.15
83 0.17
84 0.17
85 0.18
86 0.19
87 0.19
88 0.26
89 0.31
90 0.34
91 0.36
92 0.37
93 0.37
94 0.36
95 0.35
96 0.29
97 0.25
98 0.22
99 0.21
100 0.2
101 0.2
102 0.18
103 0.17
104 0.16
105 0.17
106 0.16
107 0.18
108 0.17
109 0.16
110 0.16
111 0.16
112 0.16
113 0.16
114 0.18
115 0.12
116 0.11
117 0.11
118 0.1
119 0.12
120 0.12
121 0.11
122 0.1
123 0.1
124 0.1
125 0.1
126 0.1
127 0.08
128 0.07
129 0.07
130 0.06
131 0.06
132 0.06
133 0.05
134 0.05
135 0.06
136 0.06
137 0.07
138 0.12
139 0.11
140 0.12
141 0.11
142 0.15
143 0.15
144 0.2
145 0.25
146 0.21
147 0.23
148 0.27
149 0.28
150 0.27
151 0.28
152 0.26
153 0.23
154 0.23
155 0.22
156 0.19
157 0.17
158 0.16
159 0.16
160 0.12
161 0.11
162 0.12
163 0.13
164 0.12
165 0.12
166 0.11
167 0.11
168 0.11
169 0.11
170 0.09
171 0.1
172 0.1
173 0.1
174 0.12
175 0.13
176 0.13
177 0.13
178 0.15
179 0.16
180 0.2
181 0.23
182 0.23
183 0.25
184 0.26
185 0.29
186 0.3
187 0.29
188 0.26
189 0.26
190 0.27
191 0.23
192 0.24
193 0.23
194 0.27
195 0.33
196 0.32
197 0.37
198 0.38
199 0.39
200 0.39
201 0.41
202 0.35
203 0.3
204 0.3
205 0.23
206 0.24
207 0.29
208 0.3
209 0.26
210 0.28
211 0.27
212 0.3
213 0.32
214 0.31
215 0.32
216 0.38
217 0.44
218 0.46
219 0.5
220 0.5
221 0.49
222 0.47
223 0.41
224 0.4
225 0.4
226 0.41
227 0.43
228 0.46
229 0.51
230 0.53
231 0.6
232 0.6
233 0.59
234 0.6
235 0.55
236 0.52
237 0.52
238 0.53
239 0.5
240 0.47
241 0.41
242 0.36
243 0.4
244 0.38
245 0.35
246 0.36
247 0.33
248 0.32
249 0.34
250 0.33
251 0.36
252 0.45
253 0.52
254 0.57
255 0.65
256 0.66
257 0.74
258 0.8
259 0.82
260 0.82