Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507ARS8

Protein Details
Accession A0A507ARS8    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
118-141EAQSPTKKRKSPAKKAGKKAPLSAHydrophilic
NLS Segment(s)
PositionSequence
74-92GPGRKRKTPAKSRAKATPK
124-138KKRKSPAKKAGKKAP
Subcellular Location(s) nucl 16, cyto_nucl 12, cyto 6, mito 4
Family & Domain DBs
Amino Acid Sequences MASPAPKMKGALTERDLEIMAKAWHCMKAEPEVDFAKLAELTGMTNPRSAGNAWRNIKTKLFADLPPAEPATPGPGRKRKTPAKSRAKATPKAAAAPASDDEDNKLIATADSDVDELEAQSPTKKRKSPAKKAGKKAPLSAAKVEDDSDEDGEIKTEPIKAEEQEEYIEEDVGEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.36
3 0.35
4 0.26
5 0.23
6 0.18
7 0.17
8 0.13
9 0.14
10 0.15
11 0.18
12 0.19
13 0.2
14 0.19
15 0.25
16 0.27
17 0.27
18 0.28
19 0.26
20 0.26
21 0.25
22 0.23
23 0.16
24 0.13
25 0.12
26 0.08
27 0.07
28 0.07
29 0.1
30 0.13
31 0.12
32 0.13
33 0.13
34 0.14
35 0.15
36 0.15
37 0.2
38 0.24
39 0.32
40 0.34
41 0.4
42 0.42
43 0.43
44 0.45
45 0.39
46 0.33
47 0.29
48 0.29
49 0.24
50 0.27
51 0.27
52 0.27
53 0.27
54 0.26
55 0.21
56 0.18
57 0.17
58 0.16
59 0.16
60 0.17
61 0.22
62 0.29
63 0.32
64 0.38
65 0.46
66 0.5
67 0.58
68 0.65
69 0.69
70 0.72
71 0.76
72 0.74
73 0.75
74 0.73
75 0.69
76 0.62
77 0.57
78 0.47
79 0.42
80 0.39
81 0.31
82 0.24
83 0.2
84 0.18
85 0.14
86 0.13
87 0.12
88 0.12
89 0.11
90 0.11
91 0.09
92 0.08
93 0.06
94 0.06
95 0.06
96 0.06
97 0.06
98 0.06
99 0.06
100 0.06
101 0.06
102 0.06
103 0.06
104 0.06
105 0.06
106 0.06
107 0.1
108 0.14
109 0.2
110 0.27
111 0.31
112 0.37
113 0.47
114 0.58
115 0.66
116 0.73
117 0.78
118 0.81
119 0.86
120 0.9
121 0.88
122 0.81
123 0.74
124 0.73
125 0.69
126 0.63
127 0.58
128 0.5
129 0.43
130 0.4
131 0.36
132 0.27
133 0.21
134 0.19
135 0.16
136 0.14
137 0.13
138 0.12
139 0.12
140 0.12
141 0.1
142 0.09
143 0.11
144 0.11
145 0.14
146 0.17
147 0.17
148 0.21
149 0.22
150 0.22
151 0.21
152 0.22
153 0.22
154 0.2
155 0.19