Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507AN65

Protein Details
Accession A0A507AN65   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
156-178PPPTVKGPEKKAEKKPAAKTDGPBasic
NLS Segment(s)
PositionSequence
164-171EKKAEKKP
Subcellular Location(s) cyto 17, extr 4, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR003732  Daa-tRNA_deacyls_DTD  
IPR023509  DTD-like_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0051499  F:D-aminoacyl-tRNA deacylase activity  
GO:0000049  F:tRNA binding  
Pfam View protein in Pfam  
PF02580  Tyr_Deacylase  
Amino Acid Sequences MKAILQRVLSASVTVDKEVVSSIGKGILVFAAVAPGDTEKEADSLANKVVKMRLWDDEAGGRWKHSVQDIEGEVLCVSQFTLLASTKKGSKPDFHGAQGGPEAKRLYHYFLQKVRDGYNADKVKDGVFQAMMEVALVNDGPTDKATKVTLELNANPPPTVKGPEKKAEKKPAAKTDGPSADGTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.13
4 0.13
5 0.14
6 0.13
7 0.09
8 0.09
9 0.09
10 0.1
11 0.1
12 0.1
13 0.1
14 0.08
15 0.07
16 0.07
17 0.06
18 0.05
19 0.05
20 0.05
21 0.05
22 0.06
23 0.06
24 0.06
25 0.07
26 0.07
27 0.07
28 0.08
29 0.08
30 0.08
31 0.09
32 0.12
33 0.14
34 0.13
35 0.15
36 0.16
37 0.18
38 0.2
39 0.21
40 0.21
41 0.22
42 0.22
43 0.22
44 0.22
45 0.23
46 0.24
47 0.21
48 0.19
49 0.16
50 0.16
51 0.17
52 0.17
53 0.17
54 0.13
55 0.17
56 0.18
57 0.19
58 0.18
59 0.17
60 0.13
61 0.11
62 0.1
63 0.06
64 0.05
65 0.03
66 0.03
67 0.03
68 0.05
69 0.07
70 0.07
71 0.08
72 0.1
73 0.13
74 0.15
75 0.19
76 0.19
77 0.21
78 0.27
79 0.34
80 0.35
81 0.32
82 0.34
83 0.29
84 0.28
85 0.28
86 0.24
87 0.16
88 0.16
89 0.15
90 0.12
91 0.15
92 0.15
93 0.18
94 0.2
95 0.24
96 0.28
97 0.32
98 0.36
99 0.36
100 0.37
101 0.33
102 0.32
103 0.31
104 0.28
105 0.33
106 0.33
107 0.3
108 0.3
109 0.29
110 0.26
111 0.25
112 0.23
113 0.15
114 0.12
115 0.11
116 0.1
117 0.1
118 0.09
119 0.06
120 0.06
121 0.04
122 0.04
123 0.04
124 0.03
125 0.03
126 0.04
127 0.05
128 0.05
129 0.08
130 0.08
131 0.1
132 0.11
133 0.12
134 0.14
135 0.16
136 0.2
137 0.23
138 0.25
139 0.29
140 0.32
141 0.32
142 0.3
143 0.28
144 0.27
145 0.25
146 0.28
147 0.3
148 0.34
149 0.4
150 0.5
151 0.59
152 0.65
153 0.73
154 0.78
155 0.8
156 0.81
157 0.84
158 0.85
159 0.82
160 0.78
161 0.72
162 0.71
163 0.66
164 0.59