Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507ANW4

Protein Details
Accession A0A507ANW4    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
126-162PLPSARPIKKVKPSTRPTKKVKPSARPTKKAKTEAASHydrophilic
NLS Segment(s)
PositionSequence
128-158PSARPIKKVKPSTRPTKKVKPSARPTKKAKT
Subcellular Location(s) nucl 19.5, cyto_nucl 13.333, mito_nucl 10.666, cyto 5
Family & Domain DBs
Amino Acid Sequences MKPENKTVSPAPEAADANPEVFDTLTEKEMRGLIKIFACMKNKLEIDYEKFQLATGWAKGTCTNFLSAVRKKGVFDPAVNGKGPDKKRKHAEIDQVALETEHEDDEHEDDEEEVKVIPKNENGRTPLPSARPIKKVKPSTRPTKKVKPSARPTKKAKTEAASEAVKVKEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.23
4 0.2
5 0.19
6 0.17
7 0.12
8 0.11
9 0.11
10 0.09
11 0.1
12 0.13
13 0.13
14 0.13
15 0.14
16 0.17
17 0.17
18 0.16
19 0.16
20 0.16
21 0.16
22 0.2
23 0.23
24 0.26
25 0.29
26 0.3
27 0.31
28 0.34
29 0.33
30 0.32
31 0.32
32 0.3
33 0.33
34 0.34
35 0.34
36 0.28
37 0.27
38 0.25
39 0.21
40 0.19
41 0.15
42 0.12
43 0.12
44 0.12
45 0.13
46 0.15
47 0.16
48 0.16
49 0.14
50 0.14
51 0.13
52 0.16
53 0.23
54 0.24
55 0.27
56 0.27
57 0.27
58 0.27
59 0.29
60 0.31
61 0.26
62 0.23
63 0.23
64 0.26
65 0.27
66 0.26
67 0.23
68 0.2
69 0.25
70 0.29
71 0.35
72 0.34
73 0.39
74 0.46
75 0.52
76 0.57
77 0.56
78 0.61
79 0.56
80 0.55
81 0.48
82 0.42
83 0.35
84 0.28
85 0.21
86 0.12
87 0.08
88 0.05
89 0.04
90 0.05
91 0.05
92 0.07
93 0.07
94 0.07
95 0.07
96 0.07
97 0.08
98 0.07
99 0.07
100 0.06
101 0.07
102 0.09
103 0.1
104 0.12
105 0.15
106 0.22
107 0.26
108 0.31
109 0.34
110 0.35
111 0.37
112 0.39
113 0.39
114 0.36
115 0.4
116 0.43
117 0.44
118 0.5
119 0.53
120 0.58
121 0.63
122 0.7
123 0.71
124 0.74
125 0.77
126 0.8
127 0.85
128 0.86
129 0.86
130 0.86
131 0.87
132 0.87
133 0.88
134 0.88
135 0.87
136 0.9
137 0.91
138 0.9
139 0.88
140 0.89
141 0.88
142 0.84
143 0.8
144 0.75
145 0.7
146 0.66
147 0.63
148 0.54
149 0.46
150 0.44