Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507BLZ5

Protein Details
Accession A0A507BLZ5   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
90-132ATPKAKATPKRKAKKDDDGEASATPKKRARKAAKKQEVKEVIEHydrophilic
NLS Segment(s)
PositionSequence
92-124PKAKATPKRKAKKDDDGEASATPKKRARKAAKK
Subcellular Location(s) cyto_nucl 12, mito 4, nucl 20
Family & Domain DBs
Amino Acid Sequences MSATPKKATAAAAGEVDKKNRHGLTENELRIATACLLSLKDGDFAVDKDKLAYHGGYSTPESARVSTGPIIKKLKALMADNGDGTAPAPATPKAKATPKRKAKKDDDGEASATPKKRARKAAKKQEVKEVIEVEEQAADQSEDEGHDLVLQSELEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.31
4 0.29
5 0.28
6 0.33
7 0.31
8 0.32
9 0.32
10 0.34
11 0.38
12 0.45
13 0.44
14 0.39
15 0.38
16 0.35
17 0.31
18 0.28
19 0.2
20 0.1
21 0.09
22 0.08
23 0.08
24 0.09
25 0.09
26 0.08
27 0.09
28 0.08
29 0.09
30 0.09
31 0.09
32 0.12
33 0.12
34 0.12
35 0.11
36 0.12
37 0.13
38 0.13
39 0.13
40 0.1
41 0.1
42 0.11
43 0.12
44 0.13
45 0.14
46 0.12
47 0.14
48 0.14
49 0.13
50 0.13
51 0.12
52 0.12
53 0.13
54 0.17
55 0.17
56 0.22
57 0.24
58 0.23
59 0.25
60 0.23
61 0.22
62 0.2
63 0.2
64 0.18
65 0.18
66 0.18
67 0.16
68 0.16
69 0.14
70 0.11
71 0.09
72 0.07
73 0.04
74 0.04
75 0.05
76 0.07
77 0.08
78 0.09
79 0.12
80 0.15
81 0.24
82 0.32
83 0.4
84 0.49
85 0.58
86 0.68
87 0.73
88 0.79
89 0.79
90 0.81
91 0.79
92 0.77
93 0.72
94 0.65
95 0.59
96 0.5
97 0.45
98 0.38
99 0.33
100 0.29
101 0.28
102 0.33
103 0.38
104 0.48
105 0.57
106 0.64
107 0.73
108 0.8
109 0.86
110 0.88
111 0.85
112 0.85
113 0.81
114 0.73
115 0.66
116 0.56
117 0.48
118 0.4
119 0.37
120 0.27
121 0.2
122 0.16
123 0.12
124 0.11
125 0.08
126 0.07
127 0.07
128 0.07
129 0.07
130 0.09
131 0.09
132 0.08
133 0.09
134 0.09
135 0.09
136 0.1