Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A507BLZ5

Protein Details
Accession A0A507BLZ5    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
90-132ATPKAKATPKRKAKKDDDGEASATPKKRARKAAKKQEVKEVIEHydrophilic
NLS Segment(s)
PositionSequence
92-124PKAKATPKRKAKKDDDGEASATPKKRARKAAKK
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MSATPKKATAAAAGEVDKKNRHGLTENELRIATACLLSLKDGDFAVDKDKLAYHGGYSTPESARVSTGPIIKKLKALMADNGDGTAPAPATPKAKATPKRKAKKDDDGEASATPKKRARKAAKKQEVKEVIEVEEQAADQSEDEGHDLVLQSELEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.31
4 0.29
5 0.28
6 0.33
7 0.31
8 0.32
9 0.32
10 0.34
11 0.38
12 0.45
13 0.44
14 0.39
15 0.38
16 0.35
17 0.31
18 0.28
19 0.2
20 0.1
21 0.09
22 0.08
23 0.08
24 0.09
25 0.09
26 0.08
27 0.09
28 0.08
29 0.09
30 0.09
31 0.09
32 0.12
33 0.12
34 0.12
35 0.11
36 0.12
37 0.13
38 0.13
39 0.13
40 0.1
41 0.1
42 0.11
43 0.12
44 0.13
45 0.14
46 0.12
47 0.14
48 0.14
49 0.13
50 0.13
51 0.12
52 0.12
53 0.13
54 0.17
55 0.17
56 0.22
57 0.24
58 0.23
59 0.25
60 0.23
61 0.22
62 0.2
63 0.2
64 0.18
65 0.18
66 0.18
67 0.16
68 0.16
69 0.14
70 0.11
71 0.09
72 0.07
73 0.04
74 0.04
75 0.05
76 0.07
77 0.08
78 0.09
79 0.12
80 0.15
81 0.24
82 0.32
83 0.4
84 0.49
85 0.58
86 0.68
87 0.73
88 0.79
89 0.79
90 0.81
91 0.79
92 0.77
93 0.72
94 0.65
95 0.59
96 0.5
97 0.45
98 0.38
99 0.33
100 0.29
101 0.28
102 0.33
103 0.38
104 0.48
105 0.57
106 0.64
107 0.73
108 0.8
109 0.86
110 0.88
111 0.85
112 0.85
113 0.81
114 0.73
115 0.66
116 0.56
117 0.48
118 0.4
119 0.37
120 0.27
121 0.2
122 0.16
123 0.12
124 0.11
125 0.08
126 0.07
127 0.07
128 0.07
129 0.07
130 0.09
131 0.09
132 0.08
133 0.09
134 0.09
135 0.09
136 0.1