Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507BDY9

Protein Details
Accession A0A507BDY9    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
55-79FQRSQRSGMAKGKRRKPRGPSVGGAHydrophilic
NLS Segment(s)
PositionSequence
63-75MAKGKRRKPRGPS
Subcellular Location(s) mito 14, nucl 7, cyto 3, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004274  FCP1_dom  
IPR036412  HAD-like_sf  
IPR023214  HAD_sf  
Pfam View protein in Pfam  
PF03031  NIF  
PROSITE View protein in PROSITE  
PS50969  FCP1  
Amino Acid Sequences MQLKIAPKRVLRTSIASRLLSSAIPDLTLSRPQRHQRLAETVTIQPSQSFASQPFQRSQRSGMAKGKRRKPRGPSVGGAGQRGSGSSGSAALPSQMPGNKELPSTAAWQDPTFHENLMASQPLMPGPMPLLPQFNIGQTMPMIPFMPMFSGAMPGPMLYNQSTPLVPDFTPFQQGPAPLMQQQQLPLRPQSATQLPSNGSTPNADQAPSSKKNKILTRDAIVPPSKESGGVPDPSPSYLARASFLPQRTPASKPLLVVIDLNGTLLHRPNRASPSKFVARPHAAAFLSYCIRTFWVVIWSSARPANVRSMCARLIPEPELSGRVVAVWGRDRFGLSADDFNRRVQCYKRLTRVWEDDVVARSHPAYAQGGRWTQGNTVLVDDSIEKARSEPHNLLQIPEFAGDVNEKPEILPQVHDYLNELCFQSDVSTYIRKYPYKPGPEGWTPETPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.61
3 0.54
4 0.49
5 0.44
6 0.42
7 0.34
8 0.28
9 0.22
10 0.16
11 0.15
12 0.15
13 0.15
14 0.16
15 0.25
16 0.27
17 0.3
18 0.39
19 0.48
20 0.57
21 0.62
22 0.64
23 0.63
24 0.68
25 0.65
26 0.61
27 0.56
28 0.51
29 0.48
30 0.43
31 0.37
32 0.27
33 0.25
34 0.22
35 0.19
36 0.18
37 0.16
38 0.23
39 0.28
40 0.31
41 0.37
42 0.4
43 0.44
44 0.45
45 0.47
46 0.48
47 0.49
48 0.53
49 0.55
50 0.6
51 0.64
52 0.71
53 0.77
54 0.78
55 0.81
56 0.82
57 0.83
58 0.84
59 0.84
60 0.82
61 0.75
62 0.72
63 0.7
64 0.63
65 0.55
66 0.44
67 0.35
68 0.28
69 0.24
70 0.19
71 0.12
72 0.1
73 0.08
74 0.1
75 0.09
76 0.09
77 0.09
78 0.08
79 0.09
80 0.09
81 0.12
82 0.13
83 0.14
84 0.17
85 0.2
86 0.2
87 0.2
88 0.2
89 0.18
90 0.18
91 0.2
92 0.18
93 0.19
94 0.19
95 0.19
96 0.21
97 0.21
98 0.22
99 0.19
100 0.17
101 0.15
102 0.14
103 0.15
104 0.15
105 0.13
106 0.11
107 0.11
108 0.11
109 0.11
110 0.11
111 0.1
112 0.08
113 0.08
114 0.1
115 0.1
116 0.11
117 0.14
118 0.13
119 0.16
120 0.16
121 0.16
122 0.16
123 0.15
124 0.14
125 0.12
126 0.13
127 0.11
128 0.11
129 0.1
130 0.08
131 0.08
132 0.08
133 0.08
134 0.07
135 0.07
136 0.07
137 0.08
138 0.08
139 0.08
140 0.08
141 0.07
142 0.07
143 0.07
144 0.09
145 0.08
146 0.08
147 0.09
148 0.1
149 0.1
150 0.11
151 0.12
152 0.12
153 0.11
154 0.12
155 0.13
156 0.13
157 0.17
158 0.16
159 0.17
160 0.16
161 0.16
162 0.17
163 0.16
164 0.17
165 0.15
166 0.17
167 0.17
168 0.16
169 0.19
170 0.22
171 0.23
172 0.24
173 0.22
174 0.22
175 0.21
176 0.2
177 0.21
178 0.21
179 0.21
180 0.19
181 0.21
182 0.2
183 0.21
184 0.21
185 0.18
186 0.14
187 0.13
188 0.12
189 0.12
190 0.12
191 0.11
192 0.1
193 0.13
194 0.2
195 0.24
196 0.28
197 0.28
198 0.32
199 0.38
200 0.43
201 0.46
202 0.46
203 0.43
204 0.42
205 0.46
206 0.43
207 0.41
208 0.38
209 0.32
210 0.26
211 0.24
212 0.21
213 0.14
214 0.13
215 0.13
216 0.14
217 0.15
218 0.14
219 0.14
220 0.14
221 0.14
222 0.16
223 0.11
224 0.11
225 0.11
226 0.11
227 0.11
228 0.11
229 0.13
230 0.17
231 0.18
232 0.17
233 0.18
234 0.21
235 0.22
236 0.25
237 0.27
238 0.28
239 0.28
240 0.27
241 0.27
242 0.25
243 0.23
244 0.2
245 0.16
246 0.11
247 0.09
248 0.09
249 0.07
250 0.06
251 0.06
252 0.09
253 0.11
254 0.12
255 0.13
256 0.17
257 0.25
258 0.31
259 0.33
260 0.33
261 0.38
262 0.43
263 0.45
264 0.43
265 0.44
266 0.41
267 0.4
268 0.39
269 0.36
270 0.29
271 0.26
272 0.25
273 0.19
274 0.17
275 0.15
276 0.14
277 0.1
278 0.11
279 0.11
280 0.11
281 0.09
282 0.13
283 0.13
284 0.14
285 0.16
286 0.16
287 0.18
288 0.19
289 0.18
290 0.15
291 0.15
292 0.23
293 0.22
294 0.24
295 0.24
296 0.26
297 0.26
298 0.27
299 0.27
300 0.2
301 0.22
302 0.22
303 0.2
304 0.18
305 0.18
306 0.18
307 0.17
308 0.15
309 0.11
310 0.09
311 0.09
312 0.08
313 0.1
314 0.15
315 0.15
316 0.16
317 0.17
318 0.17
319 0.17
320 0.18
321 0.18
322 0.13
323 0.2
324 0.21
325 0.26
326 0.27
327 0.3
328 0.32
329 0.31
330 0.34
331 0.32
332 0.38
333 0.42
334 0.5
335 0.56
336 0.58
337 0.62
338 0.66
339 0.68
340 0.64
341 0.58
342 0.51
343 0.46
344 0.43
345 0.38
346 0.3
347 0.24
348 0.19
349 0.16
350 0.15
351 0.14
352 0.15
353 0.15
354 0.18
355 0.23
356 0.24
357 0.24
358 0.26
359 0.24
360 0.22
361 0.25
362 0.24
363 0.19
364 0.19
365 0.19
366 0.16
367 0.16
368 0.16
369 0.13
370 0.14
371 0.14
372 0.13
373 0.13
374 0.2
375 0.23
376 0.29
377 0.31
378 0.33
379 0.41
380 0.41
381 0.43
382 0.38
383 0.36
384 0.31
385 0.27
386 0.22
387 0.13
388 0.14
389 0.14
390 0.13
391 0.14
392 0.13
393 0.13
394 0.13
395 0.17
396 0.19
397 0.18
398 0.2
399 0.2
400 0.25
401 0.26
402 0.26
403 0.25
404 0.24
405 0.24
406 0.24
407 0.21
408 0.16
409 0.15
410 0.16
411 0.14
412 0.12
413 0.13
414 0.15
415 0.2
416 0.21
417 0.29
418 0.36
419 0.38
420 0.41
421 0.5
422 0.56
423 0.59
424 0.63
425 0.61
426 0.62
427 0.66
428 0.69
429 0.64