Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A507AR67

Protein Details
Accession A0A507AR67    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
47-75IHFATMKPEQKKKKDPKGKGGKGGPPAKKBasic
NLS Segment(s)
PositionSequence
55-75EQKKKKDPKGKGGKGGPPAKK
Subcellular Location(s) cyto 8, plas 7, E.R. 5, mito 3, extr 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGQFDWFAKIGATPQAVAVLNDQPYLFTVLLVVLVVIILQCLLIWYIHFATMKPEQKKKKDPKGKGGKGGPPAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.16
4 0.16
5 0.16
6 0.15
7 0.14
8 0.15
9 0.14
10 0.11
11 0.12
12 0.14
13 0.12
14 0.08
15 0.08
16 0.07
17 0.07
18 0.07
19 0.06
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.03
30 0.03
31 0.03
32 0.05
33 0.05
34 0.08
35 0.08
36 0.08
37 0.12
38 0.21
39 0.29
40 0.34
41 0.42
42 0.5
43 0.59
44 0.7
45 0.76
46 0.79
47 0.82
48 0.85
49 0.87
50 0.89
51 0.89
52 0.88
53 0.85
54 0.81
55 0.8