Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507AKH1

Protein Details
Accession A0A507AKH1    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
90-113QFDGPRRIDRKKPLRKCQEWTAETHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 11, nucl 10.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046670  DUF6540  
Pfam View protein in Pfam  
PF20174  DUF6540  
Amino Acid Sequences MSLPVYLVESLGAPRNHHALFVELDPRHESGMLFHVTGNIQEGMDFEKRPTEYPKLENTYVAHRLLGTLSSSDLDTMEAVCRSNPPPEKQFDGPRRIDRKKPLRKCQEWTAETIRLLEQQGILRPASGAASSSSTSGSHTQPSTDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.24
3 0.24
4 0.24
5 0.23
6 0.19
7 0.2
8 0.21
9 0.27
10 0.21
11 0.24
12 0.25
13 0.25
14 0.23
15 0.21
16 0.18
17 0.12
18 0.17
19 0.16
20 0.14
21 0.14
22 0.14
23 0.14
24 0.14
25 0.14
26 0.1
27 0.08
28 0.08
29 0.09
30 0.11
31 0.13
32 0.13
33 0.11
34 0.15
35 0.15
36 0.18
37 0.22
38 0.24
39 0.26
40 0.3
41 0.37
42 0.39
43 0.38
44 0.38
45 0.35
46 0.34
47 0.33
48 0.3
49 0.22
50 0.17
51 0.16
52 0.14
53 0.13
54 0.08
55 0.05
56 0.05
57 0.06
58 0.06
59 0.06
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.07
69 0.09
70 0.15
71 0.19
72 0.23
73 0.27
74 0.3
75 0.35
76 0.37
77 0.46
78 0.47
79 0.5
80 0.51
81 0.56
82 0.62
83 0.62
84 0.65
85 0.66
86 0.7
87 0.73
88 0.78
89 0.8
90 0.82
91 0.83
92 0.83
93 0.82
94 0.82
95 0.72
96 0.68
97 0.63
98 0.55
99 0.49
100 0.43
101 0.34
102 0.26
103 0.26
104 0.2
105 0.17
106 0.15
107 0.19
108 0.19
109 0.18
110 0.16
111 0.16
112 0.15
113 0.14
114 0.11
115 0.09
116 0.08
117 0.11
118 0.11
119 0.12
120 0.13
121 0.12
122 0.15
123 0.17
124 0.18
125 0.21
126 0.21