Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A507B467

Protein Details
Accession A0A507B467    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
69-95SASVAASARKHRKKKRRQDVRIVTELIHydrophilic
NLS Segment(s)
PositionSequence
76-85ARKHRKKKRR
Subcellular Location(s) nucl 14, cyto 8, mito 3
Family & Domain DBs
Amino Acid Sequences MSDQVSSQDTSSGLPIKTLREVYDLVDWAESLRTHLDELGVDYLLDNQPDPALKRDDEDDDDNKVVDQSASVAASARKHRKKKRRQDVRIVTELIRASVQPAAAVLQDNGYALDAPMQPRGRFDAVIYAMQQHAWRSGLVRDLVLRLCVVDADSCDTLAAYQGELVELRRRMHCAGCYPGDAHFMWAAVLGLRLAYPALFAELDERLRARELDLPRLMQRIARKAIKETVVVSPSKGTPVRERP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.22
4 0.27
5 0.28
6 0.26
7 0.25
8 0.26
9 0.25
10 0.28
11 0.26
12 0.22
13 0.2
14 0.18
15 0.15
16 0.16
17 0.14
18 0.11
19 0.12
20 0.12
21 0.12
22 0.13
23 0.13
24 0.11
25 0.13
26 0.13
27 0.11
28 0.1
29 0.09
30 0.12
31 0.12
32 0.12
33 0.1
34 0.09
35 0.1
36 0.12
37 0.14
38 0.15
39 0.18
40 0.18
41 0.19
42 0.22
43 0.25
44 0.27
45 0.3
46 0.28
47 0.28
48 0.28
49 0.27
50 0.24
51 0.2
52 0.16
53 0.11
54 0.09
55 0.06
56 0.07
57 0.07
58 0.07
59 0.08
60 0.09
61 0.14
62 0.22
63 0.31
64 0.39
65 0.49
66 0.59
67 0.69
68 0.79
69 0.86
70 0.89
71 0.9
72 0.91
73 0.92
74 0.92
75 0.89
76 0.83
77 0.74
78 0.63
79 0.55
80 0.46
81 0.35
82 0.24
83 0.17
84 0.13
85 0.11
86 0.1
87 0.06
88 0.06
89 0.06
90 0.06
91 0.07
92 0.06
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.04
99 0.04
100 0.06
101 0.07
102 0.08
103 0.13
104 0.14
105 0.14
106 0.15
107 0.18
108 0.17
109 0.16
110 0.15
111 0.15
112 0.15
113 0.16
114 0.15
115 0.13
116 0.12
117 0.13
118 0.13
119 0.09
120 0.08
121 0.08
122 0.08
123 0.08
124 0.09
125 0.12
126 0.11
127 0.11
128 0.11
129 0.12
130 0.12
131 0.11
132 0.1
133 0.07
134 0.07
135 0.06
136 0.06
137 0.05
138 0.05
139 0.08
140 0.08
141 0.08
142 0.08
143 0.08
144 0.07
145 0.08
146 0.08
147 0.05
148 0.05
149 0.05
150 0.06
151 0.06
152 0.08
153 0.11
154 0.14
155 0.16
156 0.17
157 0.2
158 0.21
159 0.24
160 0.26
161 0.26
162 0.29
163 0.29
164 0.29
165 0.27
166 0.26
167 0.26
168 0.23
169 0.2
170 0.15
171 0.13
172 0.11
173 0.11
174 0.1
175 0.06
176 0.07
177 0.05
178 0.04
179 0.04
180 0.04
181 0.04
182 0.04
183 0.04
184 0.04
185 0.06
186 0.06
187 0.06
188 0.08
189 0.1
190 0.11
191 0.12
192 0.13
193 0.12
194 0.14
195 0.14
196 0.14
197 0.2
198 0.22
199 0.3
200 0.32
201 0.35
202 0.35
203 0.38
204 0.36
205 0.33
206 0.36
207 0.36
208 0.41
209 0.44
210 0.44
211 0.47
212 0.53
213 0.52
214 0.47
215 0.42
216 0.41
217 0.39
218 0.37
219 0.33
220 0.3
221 0.27
222 0.32
223 0.32
224 0.29