Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A507AQK0

Protein Details
Accession A0A507AQK0    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
386-408AAAAARKKKKEEQRAAANKERRGHydrophilic
NLS Segment(s)
PositionSequence
185-191RKARRRR
389-407AARKKKKEEQRAAANKERR
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025124  DUF4050  
Pfam View protein in Pfam  
PF13259  DUF4050  
Amino Acid Sequences MPTMPFSDLYKSPKSPLAKLRHAHHLPPDDISSQSPDYHVDLVSRDKARQKEAVKRYLADKVRDDWNFVWPPAGTNGHDATAQKATAPANKAAEQGSSSSDSMKITPAPPLPGEEGQARDLGGDADSETGSVYSTVSEDPQHYRPRQEWTSDLSDDDEPAATGSPFRFDNPESVGAAVQTSAMARKARRRREERAEMAHNEGLACFSARRDAWTGARTVHVKPKPAPPPSPTSKRRSLWRFNSHTKHEQPAPAAQGSTGAQASATSPISPVTSNSRHSQQSVRDTTTPLTSDGDDSRKSKEGNAPPAVSYPVETLLPIPPPLLPPENPMRASISPNIYVSLYDKVIVHSLQPSCPINLSDMLKSCVAGWKRDGEWPRRSVELTNAAAAAARKKKKEEQRAAANKERRGSNAGTGVTRTISGAGGSGSGGRRLSLTGLLGRVSGEKGAEEKDKDKVKAPDKSGEAAPADHDPGAPRNIRRSIQRALGLGHNHGASVGSVEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.5
3 0.54
4 0.58
5 0.6
6 0.65
7 0.66
8 0.7
9 0.69
10 0.67
11 0.66
12 0.64
13 0.56
14 0.53
15 0.51
16 0.42
17 0.39
18 0.36
19 0.32
20 0.26
21 0.25
22 0.23
23 0.21
24 0.22
25 0.23
26 0.21
27 0.17
28 0.18
29 0.23
30 0.29
31 0.29
32 0.32
33 0.37
34 0.41
35 0.45
36 0.5
37 0.53
38 0.56
39 0.62
40 0.67
41 0.64
42 0.62
43 0.6
44 0.61
45 0.6
46 0.55
47 0.5
48 0.45
49 0.5
50 0.48
51 0.5
52 0.41
53 0.44
54 0.41
55 0.37
56 0.35
57 0.27
58 0.28
59 0.27
60 0.29
61 0.22
62 0.23
63 0.24
64 0.22
65 0.24
66 0.23
67 0.21
68 0.21
69 0.2
70 0.16
71 0.17
72 0.19
73 0.22
74 0.26
75 0.26
76 0.27
77 0.29
78 0.3
79 0.28
80 0.27
81 0.22
82 0.2
83 0.19
84 0.18
85 0.17
86 0.16
87 0.17
88 0.17
89 0.16
90 0.17
91 0.17
92 0.14
93 0.19
94 0.2
95 0.22
96 0.22
97 0.24
98 0.26
99 0.24
100 0.26
101 0.23
102 0.23
103 0.21
104 0.21
105 0.18
106 0.14
107 0.13
108 0.11
109 0.08
110 0.06
111 0.06
112 0.06
113 0.06
114 0.06
115 0.06
116 0.05
117 0.05
118 0.05
119 0.05
120 0.04
121 0.06
122 0.06
123 0.07
124 0.09
125 0.11
126 0.15
127 0.22
128 0.3
129 0.31
130 0.35
131 0.37
132 0.43
133 0.44
134 0.43
135 0.4
136 0.37
137 0.41
138 0.37
139 0.35
140 0.29
141 0.26
142 0.23
143 0.2
144 0.15
145 0.09
146 0.09
147 0.09
148 0.06
149 0.07
150 0.07
151 0.08
152 0.09
153 0.09
154 0.12
155 0.12
156 0.15
157 0.18
158 0.19
159 0.18
160 0.18
161 0.17
162 0.14
163 0.13
164 0.1
165 0.07
166 0.05
167 0.05
168 0.05
169 0.08
170 0.11
171 0.13
172 0.23
173 0.32
174 0.42
175 0.52
176 0.58
177 0.64
178 0.72
179 0.79
180 0.77
181 0.75
182 0.71
183 0.63
184 0.6
185 0.51
186 0.41
187 0.31
188 0.24
189 0.17
190 0.11
191 0.09
192 0.06
193 0.05
194 0.08
195 0.08
196 0.11
197 0.13
198 0.15
199 0.18
200 0.19
201 0.2
202 0.18
203 0.21
204 0.21
205 0.2
206 0.27
207 0.26
208 0.29
209 0.31
210 0.39
211 0.44
212 0.46
213 0.48
214 0.43
215 0.48
216 0.51
217 0.58
218 0.56
219 0.54
220 0.58
221 0.57
222 0.63
223 0.64
224 0.66
225 0.66
226 0.7
227 0.71
228 0.71
229 0.74
230 0.71
231 0.7
232 0.63
233 0.57
234 0.51
235 0.45
236 0.38
237 0.35
238 0.31
239 0.24
240 0.21
241 0.16
242 0.15
243 0.13
244 0.12
245 0.09
246 0.06
247 0.06
248 0.06
249 0.06
250 0.07
251 0.07
252 0.06
253 0.06
254 0.07
255 0.08
256 0.08
257 0.09
258 0.13
259 0.16
260 0.19
261 0.21
262 0.25
263 0.25
264 0.27
265 0.31
266 0.3
267 0.36
268 0.37
269 0.38
270 0.35
271 0.35
272 0.34
273 0.32
274 0.27
275 0.19
276 0.16
277 0.13
278 0.14
279 0.15
280 0.17
281 0.18
282 0.18
283 0.2
284 0.22
285 0.22
286 0.24
287 0.3
288 0.34
289 0.4
290 0.43
291 0.41
292 0.38
293 0.39
294 0.36
295 0.28
296 0.22
297 0.14
298 0.11
299 0.1
300 0.09
301 0.09
302 0.1
303 0.11
304 0.1
305 0.09
306 0.09
307 0.1
308 0.13
309 0.15
310 0.14
311 0.17
312 0.24
313 0.28
314 0.28
315 0.28
316 0.29
317 0.27
318 0.3
319 0.3
320 0.27
321 0.24
322 0.23
323 0.23
324 0.19
325 0.18
326 0.17
327 0.15
328 0.12
329 0.12
330 0.12
331 0.11
332 0.13
333 0.13
334 0.12
335 0.15
336 0.16
337 0.15
338 0.19
339 0.2
340 0.19
341 0.2
342 0.19
343 0.16
344 0.19
345 0.21
346 0.19
347 0.2
348 0.22
349 0.2
350 0.2
351 0.18
352 0.21
353 0.2
354 0.2
355 0.2
356 0.23
357 0.25
358 0.31
359 0.38
360 0.39
361 0.45
362 0.46
363 0.46
364 0.44
365 0.44
366 0.39
367 0.38
368 0.38
369 0.32
370 0.29
371 0.26
372 0.24
373 0.24
374 0.23
375 0.24
376 0.25
377 0.29
378 0.31
379 0.37
380 0.46
381 0.55
382 0.65
383 0.69
384 0.69
385 0.75
386 0.83
387 0.85
388 0.85
389 0.82
390 0.75
391 0.71
392 0.63
393 0.55
394 0.5
395 0.45
396 0.4
397 0.39
398 0.37
399 0.32
400 0.31
401 0.29
402 0.24
403 0.22
404 0.17
405 0.12
406 0.1
407 0.09
408 0.08
409 0.07
410 0.07
411 0.07
412 0.1
413 0.09
414 0.12
415 0.12
416 0.11
417 0.12
418 0.12
419 0.14
420 0.13
421 0.14
422 0.15
423 0.16
424 0.16
425 0.15
426 0.15
427 0.15
428 0.14
429 0.13
430 0.1
431 0.1
432 0.12
433 0.16
434 0.2
435 0.23
436 0.24
437 0.31
438 0.38
439 0.39
440 0.45
441 0.5
442 0.54
443 0.59
444 0.62
445 0.62
446 0.59
447 0.61
448 0.54
449 0.5
450 0.43
451 0.35
452 0.32
453 0.27
454 0.25
455 0.21
456 0.21
457 0.18
458 0.21
459 0.27
460 0.3
461 0.31
462 0.37
463 0.44
464 0.47
465 0.53
466 0.55
467 0.56
468 0.58
469 0.58
470 0.53
471 0.49
472 0.51
473 0.46
474 0.42
475 0.39
476 0.31
477 0.26
478 0.24
479 0.21
480 0.15