Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507B6M9

Protein Details
Accession A0A507B6M9   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
55-105TWLAPGRVTSRTRKRRKSPVYTTTTAPTPSPGPKCKPKPKSNSNGRPPSTSHydrophilic
NLS Segment(s)
PositionSequence
67-71RKRRK
Subcellular Location(s) cyto 4, cyto_nucl 4, mito 15, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021858  Fun_TF  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF11951  Fungal_trans_2  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MGGPSTALTAPAVSKRQCWECLRRQLVCDSAYPVCNQCRTKGITCPGYEDKKPLTWLAPGRVTSRTRKRRKSPVYTTTTAPTPSPGPKCKPKPKSNSNGRPPSTSLVTLEPLPDQVSEPAEPDSRQLATALTQITLGSVGGVPRVVLRTEECDAYHAAYYYLVATQLADTPFVLPSLHRFVDYLPPAMRHIIVAMAYSHHILHRPYEPDKETLGRELAAFHRHRGYAIQALNKEIGCDASRGTDATMVTVLMFLMAELQQSPLPSWRQHVDGFMALMAVRGESLSELIRRAKHSRAGLLSFLILTVYSNTTSPPAEQVMVEELIEAIEPVGDLYSFAMYPNAPAPLEIFLCIARINLLRHQAASASPEVRAAALRPAAEQILQSILGFDAEAWAASHAAYLDEWRVVARAFRAAAALYLAHALQHLYPLAARREQLRALTRHHGAALRASLGEAAARPRARRGMAWPLVVAGVTGAEDEGLRRLVKEELVRLGREQGVASPAQAARVLERYWDSGRRGWDQCFDEPYALVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.35
3 0.41
4 0.48
5 0.53
6 0.57
7 0.61
8 0.7
9 0.74
10 0.71
11 0.68
12 0.66
13 0.64
14 0.55
15 0.48
16 0.41
17 0.37
18 0.35
19 0.34
20 0.33
21 0.33
22 0.39
23 0.38
24 0.36
25 0.4
26 0.45
27 0.46
28 0.5
29 0.53
30 0.53
31 0.52
32 0.57
33 0.58
34 0.58
35 0.55
36 0.53
37 0.48
38 0.45
39 0.46
40 0.41
41 0.36
42 0.36
43 0.4
44 0.41
45 0.42
46 0.4
47 0.41
48 0.45
49 0.47
50 0.51
51 0.56
52 0.6
53 0.65
54 0.73
55 0.81
56 0.85
57 0.91
58 0.92
59 0.91
60 0.9
61 0.88
62 0.81
63 0.74
64 0.66
65 0.59
66 0.49
67 0.39
68 0.31
69 0.27
70 0.32
71 0.36
72 0.4
73 0.45
74 0.54
75 0.65
76 0.73
77 0.8
78 0.82
79 0.85
80 0.88
81 0.91
82 0.92
83 0.92
84 0.92
85 0.91
86 0.84
87 0.77
88 0.69
89 0.63
90 0.55
91 0.46
92 0.37
93 0.29
94 0.28
95 0.24
96 0.22
97 0.18
98 0.15
99 0.15
100 0.13
101 0.12
102 0.12
103 0.14
104 0.13
105 0.14
106 0.16
107 0.17
108 0.16
109 0.17
110 0.18
111 0.15
112 0.15
113 0.14
114 0.12
115 0.12
116 0.15
117 0.14
118 0.11
119 0.11
120 0.1
121 0.1
122 0.09
123 0.08
124 0.05
125 0.05
126 0.05
127 0.05
128 0.06
129 0.05
130 0.06
131 0.08
132 0.08
133 0.08
134 0.09
135 0.14
136 0.15
137 0.17
138 0.16
139 0.16
140 0.17
141 0.17
142 0.16
143 0.12
144 0.1
145 0.09
146 0.09
147 0.08
148 0.08
149 0.06
150 0.05
151 0.05
152 0.06
153 0.09
154 0.09
155 0.09
156 0.09
157 0.09
158 0.09
159 0.1
160 0.09
161 0.06
162 0.1
163 0.15
164 0.15
165 0.14
166 0.15
167 0.16
168 0.24
169 0.25
170 0.25
171 0.2
172 0.21
173 0.22
174 0.23
175 0.21
176 0.13
177 0.12
178 0.09
179 0.08
180 0.08
181 0.07
182 0.07
183 0.07
184 0.08
185 0.08
186 0.07
187 0.1
188 0.1
189 0.12
190 0.16
191 0.2
192 0.22
193 0.27
194 0.28
195 0.28
196 0.3
197 0.3
198 0.26
199 0.24
200 0.22
201 0.17
202 0.15
203 0.15
204 0.15
205 0.19
206 0.19
207 0.19
208 0.21
209 0.21
210 0.21
211 0.2
212 0.2
213 0.2
214 0.22
215 0.24
216 0.22
217 0.23
218 0.24
219 0.23
220 0.21
221 0.14
222 0.13
223 0.09
224 0.09
225 0.08
226 0.08
227 0.08
228 0.08
229 0.08
230 0.09
231 0.08
232 0.08
233 0.08
234 0.07
235 0.06
236 0.06
237 0.06
238 0.03
239 0.03
240 0.02
241 0.03
242 0.03
243 0.03
244 0.03
245 0.05
246 0.05
247 0.06
248 0.06
249 0.09
250 0.11
251 0.11
252 0.14
253 0.15
254 0.17
255 0.17
256 0.18
257 0.16
258 0.14
259 0.14
260 0.11
261 0.1
262 0.07
263 0.06
264 0.05
265 0.04
266 0.03
267 0.03
268 0.03
269 0.03
270 0.04
271 0.04
272 0.05
273 0.07
274 0.1
275 0.12
276 0.16
277 0.19
278 0.21
279 0.26
280 0.27
281 0.3
282 0.3
283 0.3
284 0.27
285 0.24
286 0.21
287 0.15
288 0.13
289 0.09
290 0.06
291 0.04
292 0.05
293 0.05
294 0.05
295 0.06
296 0.06
297 0.08
298 0.08
299 0.08
300 0.09
301 0.09
302 0.09
303 0.09
304 0.1
305 0.1
306 0.1
307 0.1
308 0.08
309 0.07
310 0.06
311 0.06
312 0.05
313 0.03
314 0.02
315 0.02
316 0.02
317 0.02
318 0.02
319 0.03
320 0.03
321 0.04
322 0.04
323 0.04
324 0.05
325 0.05
326 0.06
327 0.07
328 0.08
329 0.07
330 0.08
331 0.08
332 0.1
333 0.1
334 0.1
335 0.09
336 0.08
337 0.08
338 0.08
339 0.07
340 0.07
341 0.1
342 0.11
343 0.14
344 0.19
345 0.19
346 0.19
347 0.2
348 0.19
349 0.17
350 0.18
351 0.17
352 0.13
353 0.12
354 0.13
355 0.12
356 0.12
357 0.12
358 0.1
359 0.11
360 0.12
361 0.12
362 0.12
363 0.13
364 0.13
365 0.13
366 0.12
367 0.09
368 0.09
369 0.09
370 0.08
371 0.07
372 0.07
373 0.06
374 0.06
375 0.05
376 0.05
377 0.04
378 0.05
379 0.05
380 0.05
381 0.05
382 0.05
383 0.06
384 0.05
385 0.05
386 0.05
387 0.06
388 0.07
389 0.07
390 0.07
391 0.07
392 0.08
393 0.08
394 0.09
395 0.1
396 0.12
397 0.12
398 0.12
399 0.13
400 0.12
401 0.12
402 0.11
403 0.1
404 0.07
405 0.07
406 0.07
407 0.06
408 0.06
409 0.07
410 0.06
411 0.08
412 0.07
413 0.07
414 0.08
415 0.13
416 0.16
417 0.18
418 0.19
419 0.21
420 0.25
421 0.27
422 0.32
423 0.36
424 0.36
425 0.39
426 0.45
427 0.44
428 0.41
429 0.41
430 0.38
431 0.31
432 0.32
433 0.28
434 0.22
435 0.2
436 0.19
437 0.16
438 0.13
439 0.13
440 0.1
441 0.11
442 0.16
443 0.19
444 0.2
445 0.24
446 0.3
447 0.31
448 0.33
449 0.36
450 0.41
451 0.43
452 0.44
453 0.4
454 0.35
455 0.33
456 0.3
457 0.23
458 0.12
459 0.07
460 0.05
461 0.05
462 0.04
463 0.04
464 0.04
465 0.05
466 0.07
467 0.09
468 0.09
469 0.1
470 0.12
471 0.14
472 0.18
473 0.22
474 0.25
475 0.31
476 0.35
477 0.36
478 0.35
479 0.38
480 0.35
481 0.32
482 0.28
483 0.22
484 0.22
485 0.2
486 0.19
487 0.2
488 0.18
489 0.18
490 0.2
491 0.18
492 0.18
493 0.22
494 0.22
495 0.2
496 0.22
497 0.25
498 0.29
499 0.35
500 0.35
501 0.36
502 0.42
503 0.46
504 0.48
505 0.47
506 0.5
507 0.49
508 0.5
509 0.5
510 0.47
511 0.4