Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507AMU1

Protein Details
Accession A0A507AMU1   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
259-281KQDAPAPMNRRQRRERERAEAAAHydrophilic
NLS Segment(s)
PositionSequence
77-117HKKRIAEASNKKLRSKMIGKYHMVRFFERKKALRLEKQLKR
220-276SKPQAAKRPERPSRTKALAAERKPSLREPSSAQAKKPSIKQDAPAPMNRRQRRERER
Subcellular Location(s) cyto 3.5, cyto_nucl 13.5, nucl 22.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019310  Efg1  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF10153  Efg1  
Amino Acid Sequences MATKRSFSEVDTHPDRQHLIQGDSSAQRQKKSTHNPREDSTNWAKKRARTIERLFQKGKDGIPADVLAELERELAAHKKRIAEASNKKLRSKMIGKYHMVRFFERKKALRLEKQLKRRLENTTDPEEIAAIKADLHIAEVDKMYTMYFPFLERYISLYPVSDGFKTKDSEESADKSSAALHLRAERPPMWKTVEKAMESGTRALERLRDRKDGAESLSASKPQAAKRPERPSRTKALAAERKPSLREPSSAQAKKPSIKQDAPAPMNRRQRRERERAEAAAAAENESDGGGFFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.44
3 0.37
4 0.39
5 0.35
6 0.32
7 0.29
8 0.3
9 0.32
10 0.32
11 0.35
12 0.37
13 0.35
14 0.36
15 0.37
16 0.41
17 0.46
18 0.55
19 0.62
20 0.65
21 0.72
22 0.74
23 0.73
24 0.76
25 0.67
26 0.64
27 0.64
28 0.63
29 0.55
30 0.58
31 0.6
32 0.57
33 0.66
34 0.67
35 0.65
36 0.64
37 0.7
38 0.71
39 0.75
40 0.78
41 0.71
42 0.62
43 0.6
44 0.54
45 0.47
46 0.44
47 0.37
48 0.29
49 0.29
50 0.27
51 0.21
52 0.18
53 0.17
54 0.1
55 0.09
56 0.08
57 0.06
58 0.06
59 0.05
60 0.06
61 0.12
62 0.15
63 0.2
64 0.22
65 0.25
66 0.27
67 0.32
68 0.34
69 0.39
70 0.45
71 0.51
72 0.58
73 0.58
74 0.58
75 0.56
76 0.54
77 0.52
78 0.48
79 0.47
80 0.48
81 0.52
82 0.54
83 0.58
84 0.63
85 0.6
86 0.56
87 0.5
88 0.48
89 0.46
90 0.5
91 0.51
92 0.47
93 0.47
94 0.53
95 0.59
96 0.59
97 0.63
98 0.65
99 0.66
100 0.73
101 0.76
102 0.72
103 0.68
104 0.64
105 0.6
106 0.56
107 0.56
108 0.52
109 0.49
110 0.45
111 0.41
112 0.36
113 0.3
114 0.23
115 0.16
116 0.11
117 0.05
118 0.04
119 0.04
120 0.05
121 0.04
122 0.04
123 0.05
124 0.05
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.06
136 0.07
137 0.07
138 0.08
139 0.07
140 0.11
141 0.11
142 0.12
143 0.12
144 0.11
145 0.11
146 0.12
147 0.14
148 0.1
149 0.11
150 0.11
151 0.14
152 0.15
153 0.16
154 0.18
155 0.18
156 0.2
157 0.21
158 0.22
159 0.22
160 0.21
161 0.2
162 0.17
163 0.16
164 0.16
165 0.14
166 0.12
167 0.11
168 0.16
169 0.18
170 0.19
171 0.22
172 0.22
173 0.25
174 0.25
175 0.27
176 0.27
177 0.28
178 0.29
179 0.34
180 0.37
181 0.33
182 0.33
183 0.32
184 0.3
185 0.29
186 0.28
187 0.21
188 0.16
189 0.16
190 0.16
191 0.19
192 0.23
193 0.29
194 0.33
195 0.36
196 0.37
197 0.4
198 0.44
199 0.41
200 0.36
201 0.33
202 0.3
203 0.29
204 0.3
205 0.28
206 0.23
207 0.24
208 0.25
209 0.25
210 0.31
211 0.33
212 0.4
213 0.49
214 0.6
215 0.65
216 0.71
217 0.75
218 0.72
219 0.75
220 0.72
221 0.67
222 0.62
223 0.64
224 0.64
225 0.6
226 0.61
227 0.57
228 0.55
229 0.53
230 0.52
231 0.49
232 0.42
233 0.42
234 0.4
235 0.44
236 0.52
237 0.52
238 0.5
239 0.51
240 0.54
241 0.57
242 0.59
243 0.59
244 0.56
245 0.57
246 0.58
247 0.58
248 0.62
249 0.62
250 0.63
251 0.59
252 0.59
253 0.67
254 0.7
255 0.7
256 0.7
257 0.75
258 0.78
259 0.83
260 0.83
261 0.82
262 0.82
263 0.77
264 0.71
265 0.63
266 0.54
267 0.49
268 0.4
269 0.31
270 0.24
271 0.2
272 0.16
273 0.13
274 0.11