Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A507BF92

Protein Details
Accession A0A507BF92    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
26-54LIEQLSSPQKKKKPHRRGSKRSRAPVAAIHydrophilic
NLS Segment(s)
PositionSequence
34-50QKKKKPHRRGSKRSRAP
274-274K
Subcellular Location(s) nucl 10, mito 8, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR003615  HNH_nuc  
CDD cd00085  HNHc  
Amino Acid Sequences MGREGPRDGVRAENYEKFREAFSEILIEQLSSPQKKKKPHRRGSKRSRAPVAAIGGLPPPAAPEAGPADDDDAADLADFIDYVASEAFDDLPADLQDLTHQAWADNADALQTRYDPATLTGARVAEAILPAALDPSVADSLRTYGLADEATRGVDELLASALSAYVARASAAPPAPRSAAGRADACEICGRDWVALTYHHLVPRLVHDKAVRRRWRRADELQSVAWLCGACHAAVHRFAGHEDLARRYYTVELLLEQDEIRRFAAWVGRVRWKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.44
3 0.44
4 0.39
5 0.36
6 0.33
7 0.3
8 0.23
9 0.2
10 0.2
11 0.18
12 0.19
13 0.18
14 0.15
15 0.13
16 0.17
17 0.23
18 0.24
19 0.29
20 0.36
21 0.42
22 0.53
23 0.64
24 0.7
25 0.74
26 0.8
27 0.87
28 0.9
29 0.95
30 0.96
31 0.96
32 0.95
33 0.93
34 0.9
35 0.81
36 0.73
37 0.67
38 0.59
39 0.5
40 0.39
41 0.31
42 0.24
43 0.2
44 0.17
45 0.11
46 0.09
47 0.07
48 0.07
49 0.06
50 0.08
51 0.1
52 0.11
53 0.12
54 0.11
55 0.12
56 0.12
57 0.12
58 0.1
59 0.07
60 0.06
61 0.06
62 0.05
63 0.04
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.04
71 0.04
72 0.04
73 0.04
74 0.05
75 0.05
76 0.05
77 0.04
78 0.05
79 0.05
80 0.06
81 0.05
82 0.05
83 0.06
84 0.07
85 0.08
86 0.08
87 0.08
88 0.08
89 0.08
90 0.1
91 0.09
92 0.08
93 0.07
94 0.07
95 0.07
96 0.08
97 0.08
98 0.07
99 0.07
100 0.07
101 0.07
102 0.07
103 0.07
104 0.11
105 0.1
106 0.11
107 0.12
108 0.11
109 0.11
110 0.11
111 0.1
112 0.06
113 0.06
114 0.06
115 0.04
116 0.04
117 0.03
118 0.03
119 0.03
120 0.02
121 0.02
122 0.04
123 0.05
124 0.05
125 0.05
126 0.05
127 0.06
128 0.07
129 0.07
130 0.06
131 0.05
132 0.06
133 0.06
134 0.06
135 0.06
136 0.06
137 0.06
138 0.05
139 0.05
140 0.05
141 0.05
142 0.05
143 0.04
144 0.04
145 0.03
146 0.03
147 0.03
148 0.03
149 0.03
150 0.03
151 0.03
152 0.03
153 0.03
154 0.03
155 0.04
156 0.04
157 0.08
158 0.11
159 0.12
160 0.13
161 0.14
162 0.15
163 0.16
164 0.18
165 0.17
166 0.18
167 0.19
168 0.19
169 0.18
170 0.22
171 0.2
172 0.19
173 0.19
174 0.17
175 0.15
176 0.16
177 0.15
178 0.11
179 0.12
180 0.11
181 0.1
182 0.1
183 0.14
184 0.16
185 0.18
186 0.19
187 0.2
188 0.2
189 0.19
190 0.26
191 0.28
192 0.24
193 0.25
194 0.28
195 0.37
196 0.46
197 0.56
198 0.58
199 0.59
200 0.69
201 0.75
202 0.79
203 0.78
204 0.78
205 0.77
206 0.75
207 0.73
208 0.63
209 0.56
210 0.49
211 0.4
212 0.32
213 0.22
214 0.14
215 0.12
216 0.13
217 0.1
218 0.1
219 0.12
220 0.14
221 0.16
222 0.18
223 0.16
224 0.16
225 0.16
226 0.18
227 0.17
228 0.19
229 0.2
230 0.23
231 0.24
232 0.23
233 0.23
234 0.22
235 0.22
236 0.19
237 0.19
238 0.15
239 0.14
240 0.16
241 0.17
242 0.17
243 0.15
244 0.18
245 0.17
246 0.18
247 0.17
248 0.15
249 0.15
250 0.17
251 0.23
252 0.25
253 0.3
254 0.35
255 0.44