Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507ASS5

Protein Details
Accession A0A507ASS5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
48-70MIDENGRRRRRRKPQNAEVDKDGBasic
NLS Segment(s)
PositionSequence
54-61RRRRRRKP
Subcellular Location(s) extr 11, plas 6, E.R. 5, mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPPPHLHPKSRMTSSLFMTTIIVSFFVVGLPHVLPCPAPRVTFADGEMIDENGRRRRRRKPQNAEVDKDGMVQFESMSTDAPSPQRGTARECPVPKPRGVLGELLGFGKDEHTQTDVRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.51
3 0.42
4 0.35
5 0.31
6 0.26
7 0.21
8 0.17
9 0.13
10 0.07
11 0.07
12 0.06
13 0.05
14 0.05
15 0.05
16 0.06
17 0.06
18 0.06
19 0.06
20 0.07
21 0.07
22 0.08
23 0.12
24 0.12
25 0.12
26 0.14
27 0.18
28 0.21
29 0.21
30 0.21
31 0.2
32 0.18
33 0.19
34 0.17
35 0.13
36 0.11
37 0.11
38 0.14
39 0.18
40 0.24
41 0.28
42 0.34
43 0.44
44 0.55
45 0.65
46 0.73
47 0.77
48 0.8
49 0.86
50 0.87
51 0.81
52 0.72
53 0.63
54 0.51
55 0.42
56 0.32
57 0.21
58 0.14
59 0.1
60 0.08
61 0.06
62 0.07
63 0.05
64 0.06
65 0.06
66 0.07
67 0.08
68 0.1
69 0.12
70 0.13
71 0.15
72 0.18
73 0.2
74 0.27
75 0.33
76 0.39
77 0.43
78 0.44
79 0.48
80 0.54
81 0.56
82 0.5
83 0.46
84 0.42
85 0.39
86 0.38
87 0.34
88 0.27
89 0.26
90 0.25
91 0.21
92 0.19
93 0.14
94 0.13
95 0.12
96 0.13
97 0.11
98 0.12
99 0.15